ESTScan Details for Unigene SGN-U317907

Score 
225
Direction 
Forward
Predicted Peptide Sequence 
GLQVKPPFGSAKFLGSCNGLICLTPMSFKLMIWNPVTGKHKEFEDSFVQCAVNCYIRYGFGYDYVNDDYKVVKIFSFPRNEGRYENKVKV
YSLKYDSWKMGEAFDSGYVNAQSGMCLNGYLHWEVSHCRDSGDGDGGGGSSEIMTLDLSTETYGIMALPNCGNGNTSWSLSVLNGCLVAC
CNYHSVRTDMWVMKEYGVESSWTKLVSNITAPSGRLGYVSPLSVSENGGEVLVRLGTNISLYNARNASHESLDIHSLGYCLQVQAITYIE
SLASPNVGDTNELXEVMSLNLVSKTYNGIVALLSYGNGNFRWIVVVVATIIGKEDDEGVRV
Predicted Coding Sequence 
XCCGGGCTGCAGGTAAAACCTCCTTTTGGATCTGCAAAATTTTTGGGTTCTTGTAATGGGTTGATTTGTTTAACCCCTATGTCATTTAAA
CTTATGATATGGAACCCTGTTACTGGAAAACACAAGGAATTTGAAGATTCATTTGTTCAATGTGCTGTAAATTGTTATATACGATATGGG
TTTGGTTATGATTATGTTAATGATGATTATAAGGTGGTTAAGATCTTTAGTTTTCCGCGAAATGAGGGGAGATATGAGAATAAGGTGAAG
GTTTATAGCTTGAAGTATGATTCTTGGAAAATGGGTGAGGCGTTTGATAGTGGTTATGTTAATGCACAATCCGGGATGTGTTTGAATGGA
TATCTTCATTGGGAGGTAAGCCATTGTCGCGACTCTGGTGATGGTGATGGTGGTGGTGGTTCTTCGGAGATAATGACATTGGATTTGTCT
ACGGAGACGTATGGAATAATGGCATTGCCTAATTGTGGAAATGGGAACACTAGTTGGTCGTTGAGTGTTTTAAATGGATGTTTAGTTGCT
TGTTGCAACTATCATTCGGTTAGGACGGATATGTGGGTGATGAAGGAGTATGGTGTGGAGTCGTCGTGGACTAAGTTGGTCTCTAATATC
ACGGCCCCTTCTGGCCGTTTAGGTTATGTCTCGCCTTTGTCTGTGTCGGAGAATGGTGGTGAGGTTTTAGTGAGGCTTGGTACTAATATA
AGTTTGTACAACGCGAGGAATGCTTCACATGAATCCTTGGACATTCATTCATTGGGTTATTGTCTTCAAGTACAAGCGATTACTTACATT
GAGAGTCTAGCTTCGCCTAATGTTGGTGATACTAATGAGCTCGXGGAGGTTATGAGTTTGAATTTAGTTAGTAAGACGTATAATGGGATA
GTGGCGTTGCTTAGTTATGGAAATGGAAACTTCCGTTGGATAGTAGTTGTTGTTGCAACTATTATCGGGAAGGAAGATGATGAAGGAGTA
CGAGTGTGA
Edits in Original Sequence 
(5')XCCGGGCTGCAGGTAAAACCTCCTTTTGGATCTGCAAAATTTTTGGGTTCTTGTAATGGGTTGATTTGTTTAACCCCTATGTCATT
TAAACTTATGATATGGAACCCTGTTACTGGAAAACACAAGGAATTTGAAGATTCATTTGTTCAATGTGCTGTAAATTGTTATATACGATA
TGGGTTTGGTTATGATTATGTTAATGATGATTATAAGGTGGTTAAGATCTTTAGTTTTCCGCGAAATGAGGGGAGATATGAGAATAAGGT
GAAGGTTTATAGCTTGAAGTATGATTCTTGGAAAATGGGTGAGGCGTTTGATAGTGGTTATGTTAATGCACAATCCGGGATGTGTTTGAA
TGGATATCTTCATTGGGAGGTAAGCCATTGTCGCGACTCTGGTGATGGTGATGGTGGTGGTGGTTCTTCGGAGATAATGACATTGGATTT
GTCTACGGAGACGTATGGAATAATGGCATTGCCTAATTGTGGAAATGGGAACACTAGTTGGTCGTTGAGTGTTTTAAATGGATGTTTAGT
TGCTTGTTGCAACTATCATTCGGTTAGGACGGATATGTGGGTGATGAAGGAGTATGGTGTGGAGTCGTCGTGGACTAAGTTGGTCTCTAA
TATCACGGCCCCTTCTGGCCGTTTAGGTTATGTCTCGCCTTTGTCTGTGTCGGAGAATGGTGGTGAGGTTTTAGTGAGGCTTGGTACTAA
TATAAGTTTGTACAACGCGAGGAATGCTTCACATGAATCCTTGGACATTCATTCATTGGGTTATTGTCTTCAAGTACAAGCGATTACTTA
CATTGAGAGTCTAGCTTCGCCTAATGTTGGTGATACgTAATGAGCTCGXGGAGGTTATGAGTTTGAATTTAGTTAGTAAGACGTATAATG
GGATAGTGGCGTTGCTTAGTTATGGAAATGGAAACTTCCGTTGGATAGTAGTTGTaTGTTGCAACTATTATCGGGAtAGGAAGATGATGA
AGGAGTACGAGTGTGA(3')AGAATAGTCTCTCTTCTCCGGTCTCCCTTTGCTCGTATGGGTTATATATCGCCTTTGTTTGTGTCAAGAG
AACGATGATGAAGGTTTAGTACAGATATAAGTTTGCATAACACGAGCAACGTTTCATACAGATCCTCGGATATTCATGCAAGTAGTTACT
AACATCGAGAGCCTAGCTAGCTACGCCTCGTGTTGGTGATAAGTATTTTAGCTTACATCAAAGAAATTACTCTGCTTGTGTTGTTCTTTC
TGGAGATTTACTAGTTATGTTTGTTGTATTTTCGTCTTGTTAAAAGATCCCCATATGTATTGTTAATAATGTAAAGTTCTTGTTGTTAAA
ACTACTTGTCTTAATCTTCTTTGAAAATCAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan