Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U317978

Score 
-13
Direction 
Reverse
Predicted Peptide Sequence 
MASQPSKVDKXEKKVNKYMFSTLFTDLQNSIKLIHVMKVASDTDVDLEVGLFITQIXRIQEYGSKSGATIWLIRIYCVTIKSYPVVVTAY
IFINVXVFVFTEPDGLLETASLPAKAGVRFAYTQPPTQTPHAELX
Predicted Coding Sequence 
ATGGCGTCTCAGCCCAGCAAGGTTGATAAGXTAGAGAAGAAAGTCAACAAATACATGTTTTCTACTTTATTCACAGACTTACAAAATTCT
ATTAAGCTCATTCATGTTATGAAAGTGGCATCTGATACAGATGTTGATCTAGAGGTTGGACTCTTCATTACACAAATTXCTAGGATTCAG
GAGTACGGTTCAAAGTCTGGTGCTACGATATGGCTAATAAGAATATATTGTGTCACAATTAAGAGTTATCCTGTTGTTGTTACTGCTTAT
ATCTTCATAAATGTTGXTGTTTTTGTTTTCACTGAGCCXGACGGTCTATTGGAAACAGCCTCTCTACCTGCCAAGGCAGGGGTAAGGTTT
GCCTACACTCAACCCCCTACCCAGACCCCGCATGCGGAACTGCXX
Edits in Original Sequence 
TGCTCATTCCAGATTGGATTCAGTTCGTTGTTAATTGTTTTGCTCTTCTTCATTCTATCTCGTACAGGGCGTACATATAACTCAGCAAAA
GGATCAGATTTACCAATGATGTCCTTGTTTGTTAACTCTTTTGCTTGAACAAGTTTCACCTCCAATACTCCAGTAGGTTTCAGTTCAAGG
TCACTAACAATAAAGTAGATTGTCAAATAGAAA
(5')ATGGCGTCTCAGCCCAGCAAGGTTaGATAAGXTAGAGAAGAAAGTCAACAAAT
ACATGTTTTCTACTTTATTCACAGACTTACAAAATTCTATTAAGCTCATTCATGTTATGAAAGTgGGCATCTGATACAGATGTTGATCTA
GAGGTTGGACTCTTCATTACACAAATTXCTAGGATTCAGGAGTACGGTTCAAAGTCTGGTGCTACGATATGGCTAATAAGAATATATTGT
GTCACAATTAAGAGTTATCCTGTTGTTGTTACTGCTTATATCTTCATAAATGTTGXTGTTTTTGTTTTCACTGAGCCXGACGGTCTATTG
GAAACAGCCTCTCTACCTGCCAAGGCAGGGGTAAGGTTTGCCTACACTCAACCCCCTACCCAGACCCCGCATGCGGAACTGCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan