Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U318006

Score 
385
Direction 
Reverse
Predicted Peptide Sequence 
MVKEESLEDLQKTFVDMFGRDLAKMMGDETPTAKKRARDSGCSTMAASKRNNVNFNGTC
Predicted Coding Sequence 
ATGGTGAAGGAGGAGAGTCTAGAGGATTTGCAGAAGACGTTTGTGGATATGTTTGGTAGAGATTTAGCAAAGATGATGGGTGATGAAACT
CCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTGCAGCACAATGGCTGCATCAAAACGCAACAATGTCAACTTCAATGGCACCTGTTAG
Edits in Original Sequence 
TCATATTCTGTCACTCATCCCCATTTATTAAAAAAAATTCAACTATTACATTTTTGCGAGTTTTAGCTTTCAATTATCAACGTTTAGGTA
ATAATAGAACACTAATACAATTTATCTGTATGCAGGGAATGGGTGATTTCCTGCATGATTTGATAAACCGAATGGATCAAAATGTTGGAG
CAGCGGTAAGATATTTTGATGAGTTCTACTCCTACATGATTTTTGTGCGTGTATGATTCATTTTTGAAATGATGTGCTTATTTATTGTGT
AATTAAAA
(5')ATGGTGAAGGAGGAGAGTCTAGAGGATTTGCAGAAGACGTTTGTGGATATGTTTGGTAGAGATTTAGCAAAGATGATG
GGTGATGAAACTCCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTGCAGCACAATGGCTGCATCAAAACGCAACAATGTCAACTTCAAT
GGCACCTGTTAG(3')TTTATTTAGTTTTAAGCAAAAAATACAGAAGAGGTCCCTCCACCTCCTCTCTTTTGGTGTCTGAATTTTTGTGG
GGCTGGAGAGGAATTAACATGTTTAAATTCGGTGGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan