ESTScan Details for Unigene SGN-U318169

Score 
256
Direction 
Forward
Predicted Peptide Sequence 
MPIISTTSPRSFLQTPPPPVNIFSSGDNSLLSPSSVRFRQSGNFTTAAAAAATCASVETESTTSRYSTLPSDIIHASSAPIPEAAGTSIY
TPAAVLLQQCRHSPAILPGTGKQISAGALSII
Predicted Coding Sequence 
ATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTCAAACTCCGCCACCGCCGGTGAATATATTTTCCTCCGGCGATAATTCTCTT
CTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACTTCACCACCGCCGCAGCGGCGGCGGCGACTTGCGCTTCCGTCGAAACTGAA
TCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTATCCATGCTTCTTCGGCGCCTATTCCGGAAGCXGCCGGAACGTCAATTTAT
ACTCCGGCGGCTGTTCTCCTTCAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAAACAGATCAGTGCTGGTGCTCTCTCC
ATCATTTAA
Edits in Original Sequence 
ACCAAAAAGTAAAATAAAC(5')ATGCCCATCATATCTACTACTTCCCCTCGTTCGTTTCTTCAAACTCCGCCACCGCCGGTGAATATAT
TTTCCTCCGGCGATAATTCTCTTCTATCACCGTCTTCCGTCAGATTCCGTCAGTCCGGTAACTTCACCACCGCCGCAGCGGCGGCGGCGA
CTTGCGCTTCCGTCGAAACTGAATCTACCACGTCAAGGTACTCGACGCTGCCTTCTGACATTATCCATGCTTCTTCGGCGCCTATTCCGG
AAGCXGCCGGAACGTCAATTTATACTCCGGCGGCTGTTCTCCTTCAGCAATGTCGGCATTCACCGGCTATACTACCCGGAACTGGGAAAC
AGATCAGTGCTGGTaGCTCTCTCCATCATTTAA(3')AGCCTGTTGTATATTTTTCTGAGGCATAGTGGGAAAGAGATTTTTTAAACGAA
AAAAAAAATTAACTTAGATTTGCTATCTTTACTGTTATCTTATTAGAGTTTCTACTTGTATATGCTGATTAATACTGACATGAATTTCAA
ATCTCAGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan