ESTScan Details for Unigene SGN-U318401

Score 
1990
Direction 
Forward
Predicted Peptide Sequence 
MADSVDQMLILMQKAKISGADLVEVRVDSLKSFNPRPDIDTLIKQCPLPTLFTYRPTWEGGQYAGDEKSRLDALRLAMELGADYIDVELK
AIGEFNNALHGNKSAKCKLIVSSHNYESTPSAEDLGNLVARIQASGADIVKFATTAQDITDVARVFQITVHSQVPIIAMVMGEKGLMSRI
LCPKFGGYLTFGTLEVGKVSAPGQPTVEDLLNLYNFRQLGPDTKIFGIIGKPVSHSKSPLLYNESFRSVGFNGVFMHLLVDDIANFFRTY
SSLDFAGFSCTIPHKEAALDCCAEIDPTAKAIGAVNCIIRRPDGKLFGCNTDYIGAISAIEEGLQGSQPSISGSPLAGKLFVVIGAGGAG
KAIAYGAKEKGARVVIANRTYERARELAIVVGAEALSLDELSNFHPENDMILANTTSIGMQPKVDDTPISKEALKHYSLVFDAVYTPKIT
RLLREAQESGAKIVTGVEMFIGQAYEQYERFTGLPAPKELFKNIMSTTERIPFTFQSGLLIIITPKSDMIVLEFALSTTVCTSEEVILST
Predicted Coding Sequence 
ATGGCTGATTCAGTGGATCAAATGTTGATTCTTATGCAAAAGGCTAAAATTAGTGGGGCTGATCTTGTGGAGGTTCGAGTGGATAGCTTG
AAAAGCTTTAATCCTCGCCCAGATATTGATACCCTGATCAAACAATGCCCTTTGCCTACTCTCTTCACTTACAGGCCCACTTGGGAAGGT
GGTCAGTATGCTGGTGATGAAAAGAGTCGATTGGATGCACTTCGATTAGCGATGGAGTTGGGAGCTGATTACATTGATGTTGAGCTAAAG
GCTATTGGCGAGTTCAACAATGCCCTACATGGAAATAAATCTGCAAAATGCAAACTTATTGTTTCTTCTCACAACTATGAAAGCACACCG
TCAGCTGAGGATCTTGGCAATCTAGTAGCAAGAATACAGGCATCTGGAGCTGACATTGTGAAATTTGCTACAACTGCACAGGATATCACT
GATGTTGCACGTGTTTTCCAAATTACTGTTCATTCTCAAGTTCCAATAATAGCCATGGTCATGGGAGAGAAGGGTTTGATGTCTCGGATA
CTTTGTCCAAAATTTGGTGGATACCTCACGTTTGGTACTCTTGAAGTGGGAAAAGTTTCAGCTCCTGGGCAACCAACAGTCGAAGATCTT
CTGAATTTATACAATTTCAGACAGTTGGGACCAGATACCAAAATATTTGGCATTATTGGGAAGCCAGTTAGCCATAGCAAATCACCTTTA
TTATATAATGAATCCTTCAGATCAGTTGGGTTTAATGGTGTTTTCATGCATTTGCTGGTAGATGATATTGCAAACTTTTTCCGGACTTAT
TCATCATTAGATTTTGCTGGATTCAGCTGTACAATTCCTCACAAAGAAGCCGCTCTTGACTGCTGTGCTGAAATTGATCCTACTGCTAAG
GCAATAGGGGCTGTCAATTGTATTATAAGGCGACCTGATGGGAAGTTATTTGGTTGTAATACAGACTATATCGGTGCTATTTCCGCCATT
GAAGAAGGATTGCAAGGTTCACAACCTAGTATATCTGGGTCACCTTTGGCTGGTAAATTGTTTGTGGTCATTGGTGCTGGTGGCGCTGGA
AAGGCGATTGCTTATGGCGCAAAGGAAAAGGGGGCTAGGGTGGTGATTGCTAATCGTACCTATGAACGAGCGCGAGAACTTGCTATTGTT
GTTGGAGCTGAGGCCTTATCTCTTGACGAGCTTAGCAATTTCCATCCAGAAAATGATATGATTCTTGCAAATACCACCTCCATAGGCATG
CAACCAAAGGTTGATGATACACCAATCTCTAAGGAAGCTTTGAAGCACTACTCACTTGTTTTCGATGCTGTTTATACACCCAAAATCACT
AGACTCCTGCGAGAAGCTCAGGAGAGTGGAGCAAAAATTGTGACAGGAGTTGAAATGTTTATCGGGCAGGCATATGAACAATATGAAAGA
TTTACAGGATTGCCAGCTCCTAAGGAACTTTTCAAGAATATAATGTCTACTACTGAGAGGATCCCTTTCACTTTTCAATCGGGGCTGCTA
ATTATTATTACTCCTAAATCTGACATGATTGTGTTAGAGTTTGCTCTATCTACCACTGTTTGTACTTCAGAGGAAGTAATTTTGTCCACG
TAA
Edits in Original Sequence 
TCTTCTCCACTCACCAAACTTTGTTAACACTTCTACCAACCCACATTGGGTTTTTTTTTTTTCCTACTCTTATAAAACTAAAAAAGAACA
CTTTTTTTTTTCTGGGTTTTGATTCTTGAATTGTGGGTGTTTGAGATTTTTTGTTGTTTTTTTGTTGTCGTGGGTGTGGGGTTGTTAGGT
TGTAGATTCTGGAGTGAAGAAGATGGAGGGTGAAGCAATGAGGAAGAATCAAACTCTAATTTGTGCACCAATT
(5')ATGGCTGATTCAG
TGGATCAAATGTTGATTCTTATGCAAAAGGCTAAAATTAGTGGGGCTGATCTTGTGGAGGTTCGAGTGGATAGCTTGAAAAGCTTTAATC
CTCGCCCAGATATTGATACCCTGATCAAACAATGCCCTTTGCCTACTCTCTTCACTTACAGGCCCACTTGGGAAGGTGGTCAGTATGCTG
GTGATGAAAAGAGTCGATTGGATGCACTTCGATTAGCGATGGAGTTGGGAGCTGATTACATTGATGTTGAGCTAAAGGCTATTGGCGAGT
TCAACAATGCCCTACATGGAAATAAATCTGCAAAATGCAAACTTATTGTTTCTTCTCACAACTATGAAAGCACACCGTCAGCTGAGGATC
TTGGCAATCTAGTAGCAAGAATACAGGCATCTGGAGCTGACATTGTGAAATTTGCTACAACTGCACAGGATATCACTGATGTTGCACGTG
TTTTCCAAATTACTGTTCATTCTCAAGTTCCAATAATAGCCATGGTCATGGGAGAGAAGGGTTTGATGTCTCGGATACTTTGTCCAAAAT
TTGGTGGATACCTCACGTTTGGTACTCTTGAAGTGGGAAAAGTTTCAGCTCCTGGGCAACCAACAGTCGAAGATCTTCTGAATTTATACA
ATTTCAGACAGTTGGGACCAGATACCAAAATATTTGGCATTATTGGGAAGCCAGTTAGCCATAGCAAATCACCTTTATTATATAATGAAT
CCTTCAGATCAGTTGGGTTTAATGGTGTTTTCATGCATTTGCTGGTAGATGATATTGCAAACTTTTTCCGGACTTATTCATCATTAGATT
TTGCTGGATTCAGCTGTACAATTCCTCACAAAGAAGCCGCTCTTGACTGCTGTGCTGAAATTGATCCTACTGCTAAGGCAATAGGGGCTG
TCAATTGTATTATAAGGCGACCTGATGGGAAGTTATTTGGTTGTAATACAGACTATATCGGTGCTATTTCCGCCATTGAAGAAGGATTGC
AAGGTTCACAACCTAGTATATCTGGGTCACCTTTGGCTGGTAAATTGTTTGTGGTCATTGGTGCTGGTGGCGCTGGAAAGGCGATTGCTT
ATGGCGCAAAGGAAAAGGGGGCTAGGGTGGTGATTGCTAATCGTACCTATGAACGAGCGCGAGAACTTGCTATTGTTGTTGGAGCTGAGG
CCTTATCTCTTGACGAGCTTAGCAATTTCCATCCAGAAAATGATATGATTCTTGCAAATACCACCTCCATAGGCATGCAACCAAAGGTTG
ATGATACACCAATCTCTAAGGAAGCTTTGAAGCACTACTCACTTGTTTTCGATGCTGTTTATACACCCAAAATCACTAGACTCCTGCGAG
AAGCTCAGGAGAGTGGAGCAAAAATTGTGACAGGAGTTGAAATGTTTATCGGGCAGGCATATGAACAATATGAAAGATTTACAGGATTGC
CAGCTCCTAAGGAACTTTTCAAGAATATAATGTCTACaTACTGAGAGGATCCCTTTCACTTTTCAATCGGGGCTGCTAATTATTATTACT
CCTAAATCTGACATGATTGTGTTAGAGTTTGCTCTATCTACCACTGTTTGTACTTCAGAGGAAGTAATTTTGTCCACGTAA(3')ATCGT
ACTTTTTGCGGAAACAGAGGATGTTCAGACATACCAGTTAATCTATGGCAGGAAAATCCACCATCTTTCTGGCTATGTTAGAACTCTTGA
TTCTTTGACAAGTATTGTATTTTGGGAGGAAATTCATTAAACAGAGATGTATACATTGCTTCATCATTGTAAAATCATACTTAGAAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan