ESTScan Details for Unigene SGN-U318409

Score 
1796
Direction 
Forward
Predicted Peptide Sequence 
MGSGCSSPSISLTTIATSHFQSQESLSNSLNFYSPTRFLEPHLLKSSKIFIPKSPLKCAKVPEMQTQLEDSAKPIVDPHDIDSKLVQKLA
NDALVWCSLRGLLVGDRNSERSGTIPGVDMVHAPVALIPMSFPESHWKQACEVAPIFNELVDRVSQDGEFLQQSLSRTRKADPFTSRLLE
IHSKMLEINKLEEIRLGLHRSDYMLDEQTKLLLQIELNTISSSFPGLSCLVSELHRSLLQQYREDIASDPNRIPANNAVNQFAEALAKAW
NEYGDPRAVIIFVVQAEERNMYDQHWLSASLRERHQVTTIRKTLAEIDALGELQQDGTLVVDGQAVAVIYFRAGYAPSDYHSESEWKARL
LMEQSRAVKCPSISYHLAGSKKIQQELAKPNVLERFLENKDDIAKLRKCFAGLWSLDESDIVKDAIERPELYVMKPQREGGGNNIYGEDV
RGALLKLQKEGTGSDAAYILMQRIFPKISHSILMREGISHKEETISELGIYGTYLRNKTEVLINQQAGYLMRTKVSSSDEGGVAAGFAVL
DSITWFDGIVLRVDTITMVECRSW
Predicted Coding Sequence 
ATGGGCAGCGGCTGTTCTTCTCCATCAATCTCACTAACTACCATCGCTACCTCTCATTTTCAATCCCAAGAATCACTATCAAACTCTTTA
AATTTCTACTCACCTACTAGATTTTTGGAACCCCATCTCCTTAAATCTTCCAAGATTTTCATACCCAAATCCCCATTGAAGTGTGCTAAA
GTGCCCGAAATGCAGACCCAACTGGAAGATTCTGCGAAACCCATTGTCGATCCTCATGATATCGACTCAAAATTGGTGCAGAAGCTTGCT
AATGATGCACTTGTCTGGTGCTCTCTTCGTGGACTTCTTGTTGGTGACAGAAATTCGGAGAGGTCAGGAACTATTCCTGGTGTTGATATG
GTTCATGCTCCAGTTGCTCTCATACCAATGTCATTTCCTGAAAGTCATTGGAAGCAAGCTTGTGAAGTTGCTCCTATTTTCAATGAACTC
GTGGATCGCGTGAGTCAGGATGGAGAATTTCTGCAGCAATCACTGTCTAGGACGAGAAAAGCTGATCCTTTCACCTCCAGATTACTAGAA
ATCCACTCCAAGATGTTAGAAATCAACAAGCTAGAGGAAATACGCTTGGGGTTGCATCGCTCAGACTATATGCTGGATGAGCAAACGAAA
TTACTTTTGCAAATAGAGCTTAACACAATCTCATCATCATTTCCAGGGCTAAGTTGTCTGGTCAGCGAGCTTCACAGGAGCTTGCTTCAA
CAATACAGAGAAGACATTGCATCAGATCCTAACAGAATTCCCGCAAACAATGCTGTAAATCAATTTGCTGAAGCATTGGCTAAAGCTTGG
AATGAATATGGTGATCCAAGGGCTGTGATTATTTTTGTGGTTCAAGCTGAAGAGCGCAATATGTATGACCAGCATTGGCTTTCTGCATCA
TTGAGAGAAAGACATCAAGTTACAACTATCAGAAAGACGCTGGCTGAAATTGATGCACTTGGCGAGCTTCAACAAGATGGTACCCTTGTT
GTAGATGGTCAAGCTGTGGCAGTCATTTATTTTAGAGCTGGCTATGCACCAAGTGACTATCACTCGGAATCTGAGTGGAAAGCTAGGCTG
CTGATGGAGCAATCACGTGCAGTCAAGTGCCCTTCAATTTCTTATCATTTAGCTGGCAGCAAGAAGATTCAGCAAGAGCTTGCAAAGCCC
AATGTACTTGAAAGGTTTCTGGAAAACAAAGATGACATTGCCAAACTACGGAAATGCTTTGCAGGGTTGTGGAGCTTGGATGAATCCGAC
ATTGTCAAGGATGCAATTGAGAGGCCTGAATTGTATGTTATGAAACCACAACGAGAAGGAGGAGGAAACAATATCTATGGGGAGGATGTC
AGAGGTGCTCTTTTGAAACTGCAAAAGGAAGGCACTGGAAGTGATGCAGCCTACATACTAATGCAGAGGATTTTCCCGAAGATCTCTCAC
TCGATACTAATGCGAGAAGGCATCTCTCATAAAGAAGAAACCATATCAGAACTTGGGATATATGGTACCTATTTAAGGAACAAAACGGAA
GTTTTAATCAACCAACAGGCTGGTTACTTGATGCGAACAAAGGTCTCTTCATCAGATGAGGGGGGAGTTGCAGCCGGGTTTGCAGTTTTG
GACAGTATTACTTGGTTTGATGGAATTGTCTTGCGCGTTGACACTATAACAATGGTTGAATGCAGAAGCTGG
Edits in Original Sequence 
AGGGCCAACTCAGAACAAGATTCCCTCGCCTTTAGCAATTAGCAGCCAGCCAAACGTAAAGAGCCACTTTGGACGATAATAAGGTAGTAA
CATAAAAGATTGGTCCAAAGAATGTCAAA
(5')ATGGGCAGCGGCTGTTCTTCTCCATCAATCTCACTAACTACCATCGCTACCTCTCAT
TTTCAATCCCAAGAATCACTATCAAACTCTTTAAATTTCTACTCACCTACTAGATTTTTGGAACCCCATCTCCTTAAATCTTCCAAGATT
TTCATACCCAAATCCCCATTGAAGTGTGCTAAAGTGCCCGAAATGCAGACCCAACTGGAAGATTCTGCGAAACCCATTGTCGATCCTCAT
GATATCGACTCAAAATTGGTGCAGAAGCTTGCTAATGATGCACTTGTCTGGTGCTCTCTTCGTGGACTTCTTGTTGGTGACAGAAATTCG
GAGAGGTCAGGAACTATTCCTGGTGTTGATATGGTTCATGCTCCAGTTGCTCTCATACCAATGTCATTTCCTGAAAGTCATTGGAAGCAA
GCTTGTGAAGTTGCTCCTATTTTCAATGAACTCGTGGATCGCGTGAGTCAGGATGGAGAATTTCTGCAGCAATCACTGTCTAGGACGAGA
AAAGCTGATCCTTTCACCTCCAGATTACTAGAAATCCACTCCAAGATGTTAGAAATCAACAAGCTAGAGGAAATACGCTTGGGGTTGCAT
CGCTCAGACTATATGCTGGATGAGCAAACGAAATTACTTTTGCAAATAGAGCTTAACACAATCTCATCATCATTTCCAGGGCTAAGTTGT
CTGGTCAGCGAGCTTCACAGGAGCTTGCTTCAACAATACAGAGAAGACATTGCATCAGATCCTAACAGAATTCCCGCAAACAATGCTGTA
AATCAATTTGCTGAAGCATTGGCTAAAGCTTGGAATGAATATGGTGATCCAAGGGCTGTGATTATTTTTGTGGTTCAAGCTGAAGAGCGC
AATATGTATGACCAGCATTGGCTTTCTGCATCATTGAGAGAAAGACATCAAGTTACAACTATCAGAAAGACGCTGGCTGAAATTGATGCA
CTTGGCGAGCTTCAACAAGATGGTACCCTTGTTGTAGATGGTCAAGCTGTGGCAGTCATTTATTTTAGAGCTGGCTATGCACCAAGTGAC
TATCACTCGGAATCTGAGTGGAAAGCTAGGCTGCTGATGGAGCAATCACGTGCAGTCAAGTGCCCTTCAATTTCTTATCATTTAGCTGGC
AGCAAGAAGATTCAGCAAGAGCTTGCAAAGCCCAATGTACTTGAAAGGTTTCTGGAAAACAAAGATGACATTGCCAAACTACGGAAATGC
TTTGCAGGGTTGTGGAGCTTGGATGAATCCGACATTGTCAAGGATGCAATTGAGAGGCCTGAATTGTATGTTATGAAACCACAACGAGAA
GGAGGAGGAAACAATATCTATGGGGAGGATGTCAGAGGTGCTCTTTTGAAACTGCAAAAGGAAGGCACTGGAAGTGATGCAGCCTACATA
CTAATGCAGAGGATTTTCCCGAAGATCTCTCACTCGATACTAATGCGAGAAGGCATCTCTCATAAAGAAGAAACCATATCAGAACTTGGG
ATATATGGTACCTATTTAAGGAACAAAACGGAAGTTTTAATCAACCAACAGGCTGGTTACTTGATGCGAACAAAGGTCTCTTCATCAGAT
GAGGGGGGAGTTGCAGCCGGGTTTGCAGTTTTGGACAGTATaTACTTGGTTTGATGGAATTGTCTTGCGCGTTGACACTATAACAATGGT
TGAATGCAGAAGCTGG(3')ACAAGTCATTTCCTACATTATGTTGAGACACCATGCTTTAGCCTGTTTAACCTTTCCTTGTTTTACATTG
TATTTTTCTTGCTTAACATCTTTAATAAATAGAGCTCCACATCTGAAGGAAGTGACCAAAAGAATGGTATAGTCAATTCAAAGTGTTTGC
TTGCAATTTTAACCTATTCAGTGTTTGGACTCTTTGTTACCACAGGAGCTTTTACTGTTCTGTTCATTACATGTAATTCTGTTTCACTTT
TGTTAGTACTATCAAGATTGCTCACCTGCATTTTTGTTTTCCCCTTTGTGATCTTATTAGGGGATGTGTGAAATCTGTATTGCTTGAAAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan