ESTScan Details for Unigene SGN-U318459

Score 
1244
Direction 
Forward
Predicted Peptide Sequence 
PSHQRTQSPPPATLLIYRPRVFIAGKEIRFSDESIEVIEDLDEXYKMPPKQSKADIAKKQKVVEDKTFGLKNKNKSKNVQKYVQSLQQNV
VPKADPKKLDAKKKKEEEKAREKELSELFKVAISQPKVPLGVDPKSILCEFFKAGQCVKGFKCKFSHDLNVQRKGEKIDIFSDKRDEDGK
ETMDDWDQETLEKVVASKSQEYNKNKPTDIVCKFFLDAVEKKQYGWFWACPNGKECHYRHALPPGYILKSQMKALLQEEADKMPIEEEID
QQRAKLTASTPLTTELFMEWKKKKTEEREANLAKQRADRAKNDRMSGRELFMSDASWFVDDVGAYDKYDREEESAELPKENKDSAREEAS
SSTSAQKNIHDGGEASHKDQVDDIYDDXDDDDDFDVDELNELEASLSKTSLQINEPGSRLDPWAQNLCTWYTLISACTFMSTVMQNHVGV
QQQIKWNEMKHIPVVTP
Predicted Coding Sequence 
CCTTCTCACCAGAGAACCCAATCTCCGCCTCCGGCCACACTCTTAATTTATCGTCCTAGGGTTTTCATCGCCGGAAAAGAAATTCGATTT
TCCGACGAATCTATCGAGGTGATTGAGGATTTGGATGAGAAXTACAAGATGCCGCCAAAGCAATCTAAAGCCGATATTGCAAAGAAGCAG
AAGGTAGTTGAAGACAAGACGTTCGGTCTTAAGAATAAGAACAAGTCGAAGAATGTTCAGAAATATGTTCAGTCTTTACAGCAAAATGTT
GTGCCTAAAGCTGATCCTAAGAAACTTGACGCCAAGAAAAAGAAGGAAGAAGAGAAAGCTAGAGAGAAAGAGCTTAGCGAATTGTTCAAA
GTCGCTATTAGCCAACCTAAAGTGCCTCTAGGTGTTGATCCAAAATCTATTTTATGTGAGTTCTTTAAGGCGGGGCAATGTGTTAAGGGT
TTTAAGTGCAAGTTCTCTCACGATCTGAATGTTCAGCGAAAAGGAGAGAAGATTGATATTTTCAGCGATAAGCGTGATGAAGATGGAAAG
GAAACAATGGACGATTGGGATCAAGAGACACTGGAGAAGGTTGTGGCGTCAAAAAGTCAAGAGTATAACAAGAACAAACCAACTGACATT
GTATGTAAATTCTTTTTGGATGCGGTGGAGAAAAAGCAGTACGGTTGGTTCTGGGCCTGTCCAAATGGTAAAGAATGCCATTACAGGCAT
GCACTTCCTCCTGGATATATTCTCAAGTCACAAATGAAAGCCTTGTTACAAGAGGAAGCTGACAAGATGCCTATTGAAGAAGAAATTGAT
CAACAGCGTGCAAAATTGACTGCTTCAACTCCCTTGACCACTGAATTATTTATGGAATGGAAAAAAAAGAAGACGGAAGAAAGAGAGGCC
AATTTGGCCAAACAGAGGGCAGATAGAGCTAAGAATGATCGCATGAGTGGTCGTGAGTTGTTCATGTCGGATGCTAGTTGGTTTGTGGAT
GATGTGGGGGCCTATGACAAGTATGATAGGGAAGAAGAGTCTGCTGAACTCCCAAAGGAGAATAAGGATTCTGCTAGGGAAGAGGCAAGC
TCCTCGACATCAGCCCAGAAGAATATTCATGATGGTGGTGAGGCTTCACATAAAGACCAAGTGGATGACATTTATGACGACGAXGATGAT
GATGATGACTTTGATGTGGATGAGTTAAATGAACTGGAAGCTAGCCTTTCAAAAACATCGTTACAAATCAATGAACCTGGTAGTCGGCTT
GATCCTTGGGCCCAAAATCTATGCACATGGTATACACTTATCAGTGCATGCACTTTCATGTCTACXGTGATGCAAAATCATGTTGGCGTG
CAGCAGCAGATAAAATGGAATGAAATGAAGCATATCCCTGTCGTGACGCCTTAA
Edits in Original Sequence 
(5')CCTTCTCACCAGAGAACCCAATCTCCGCCTCCGGCCACACTCTTAATTTATCGTCCTAGGGTTTTCAgTCGCCGGAAAAGAAATTC
GATTTTCCGACGAATCTATCGAGGTGATTGAGGATTTGGATGAGAAXTACAAGATGCCGCCAAAGCAATCTAAAGCCGATATTGCAAAGA
AGCAGAAGGTAGTTGAAGACAAGACGTTCGGTCTTAAGAATAAGAACAAGTCGAAGAATGTTCAGAAATATGTTCAGTCTTTACAGCAAA
ATGTTGTGCCTAAAGCTGATCCTAAGAAACTTGACGCCAAGAAAAAGAAGGAAGAAGAGAAAGCTAGAGAGAAAGAGCTTAGCGAATTGT
TCAAAGTCGCTATTAGCCAACCTAAAGTGCCTCTAGGTGTTGATCCAAAATCTATTTTATGTGAGTTCTTTAAGGCGGGGCAATGTGTTA
AGGGTTTTAAGTGCAAGTTCTCTCACGATCTGAATGTTCAGCGAAAAGGAGAGAAGATTGATATTTTCAGCGATAAGCGTGATGAAGATG
GAAAGGAAACAATGGACGATTGGGATCAAGAGACACTGGAGAAGGTTGTGGCGTCAAAAAGTCAAGAGTATAACAAGAACAAACCAACTG
ACATTGTATGTAAATTCTTTTTGGATGCGGTGGAGAAAAAGCAGTACGGTTGGTTCTGGGCCTGTCCAAATGGTAAAGAATGCCATTACA
GGCATGCACTTCCTCCTGGATATATTCTCAAGTCACAAATGAAAGCCTTGTTACAAGAGGAAGCTGACAAGATGCCTATTGAAGAAGAAA
TTGATCAACAGCGTGCAAAATTGACTGCTTCAACTCCCTTGACCACTGAATTATTTATGGAATGGAAAAAAAAGAAGACGGAAGAAAGAG
AGGCCAATTTGGCCAAACAGAGGGCAGATAGAGCTAAGAATGATCGCATGAGTGGTCGTGAGTTGTTCATGTCGGATGCTAGTTGGTTTG
TGGATGATGTGGGGGCCTATGACAAGTATGATAGGGAAGAAGAGTCTGCTGAACTCCCAAAGGAGAATAAGGATTCTGCTAGGGAAGAGG
CAAGCTCCTCGACATCAGCCCAGAAGAATATTCATGATGGTGGTGAGGCTTCACATAAAGACCAAGTGGATGACATTTATGACGACGAXG
ATGATGATGATGACTTTGATGTGGATGAGTTAAATGAACTGGAAGCTAGCCTTTCAAAAACATCGTTACAAATCAATGAACCTGGTAGTC
GcGCTTGATCCTTGGGCCCAAAATCTATGCACATGGTATACACTTATCAGTGCATGCACTTTCATGTCTACXGTGATGCAAAATCATGTT
GGCGTGCAGCAGCAGATAAAATGGAATGAAATGtAAGCATATCCCTGTCGTGACGCCTTAA(3')TAATTGATCCTCTATTTTATTAGGT
TTTTACCCTTATTTCTAATGAGTTGTGACTTCTTTCTTTCCAGAATTTTTGATGAATTTAACTTGTCTGGTTGTTTTGCTGTCACATAAG
AGAGCTATCCTTTGTATTTTACTACTACTACTATGCTTTGAAGTGTGTTGCCTTCTCATTGCCCTTTATAATGATTCTACTACTATAGGC
GTAGTAAAAAACTTTTGATCGAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan