ESTScan Details for Unigene SGN-U318470

Score 
359
Direction 
Forward
Predicted Peptide Sequence 
RDSPDHEINTAYRKLALMYHPDQNATSPDASEHFKEVAYSYSILSDPEKRRQYXYGWLQALEAERMDMEIDLSNLGTVNTMFAALFSKLG
VPIKTTISANVLEEALNGTVTVRPLPIGTSVSGKVEKQNAHFFGVTISDEQAEAGIVVRATSAAQSKFKLLYFEHDVSGGYGLALQEDSE
KAGKVTSAGMYFLHFQVYRMDSTVNAVCGFILWLKFNSIACSVIKSDNTRDDELAMAKDPEAAFFKRLEGLQPCEVSQLNAGTHIFAVYG
DNFFKPASYTIEALCAQTYEDTT
Predicted Coding Sequence 
XCGAGGGATTCCCCGGATCACGAGATTAACACTGCTTATAGAAAGCTCGCTCTCATGTATCATCCTGACCAGAATGCAACAAGTCCTGAC
GCTTCAGAACATTTCAAGGAGGTTGCATACTCATATAGCATTCTATCTGATCCAGAGAAAAGGAGGCAATATXCATATGGCTGGCTTCAG
GCTCTTGAAGCTGAACGAATGGATATGGAAATTGATTTGTCCAACCTCGGAACTGTCAACACAATGTTTGCAGCATTGTTTAGCAAGTTG
GGTGTTCCTATCAAAACAACTATCTCTGCGAATGTTCTTGAAGAAGCTTTGAATGGAACTGTCACGGTCCGCCCTCTTCCAATTGGTACA
TCAGTCAGTGGAAAGGTAGAAAAGCAAAATGCTCATTTTTTCGGTGTAACAATTAGTGACGAACAAGCAGAAGCAGGGATTGTAGTAAGA
GCTACTTCAGCTGCCCAAAGCAAATTCAAGCTACTATATTTTGAACATGATGTGAGTGGGGGTTACGGCCTGGCCTTGCAGGAAGATAGT
GAAAAAGCAGGCAAGGTAACCTCCGCAGGAATGTATTTCTTGCACTTTCAAGTGTACAGAATGGATTCAACTGTAAATGCGGTATGTGGA
TTCATCTTGTGGTTAAAATTCAATAGTATTGCATGCAGTGTTATCAAAAGTGATAATACTCGTGATGATGAGTTAGCAATGGCCAAAGAT
CCTGAAGCTGCTTTCTTTAAGAGGCTGGAGGGTCTTCAACCTTGTGAGGTCTCACAACTAAATGCCGGCACTCACATATTTGCTGTTTAT
GGAGATAATTTCTTTAAGCCTGCTAGTTATACTATTGAGGCTCTGTGTGCCCAGACATACGAGGATACAACT
Edits in Original Sequence 
(5')XCGAGGGATTCCCCGGATCACGAGATTAACACTGCTTATAGAAAGCTCGCTCTCATGTATCATCCTGACCAGAATGCtAACAAGTC
CTGACGCTTCAGAACATTTCAAGGAGGTTGCATACTCATATAGCATTCTATCTGATCCAGAGAAAAGGAGGCAATATXCATATGGCTGGC
TTCtAGGCTCTTGAAGCTGAACGAATGGATATGGAAATTGATTTGTCCAACCTCGGAACTGTCAACACAATGTTTGCAGCATTGTTTAGC
AAGTTGGGTGTTCCTATCAAAACAACTATCTCTGCGAATGTTCTTGAAGAAGCTTTGAATGGAACTGTCACGGTCCGCCCTCTTCCAATT
GGTACATCAGTCAGTGGAAAGGTAGAAAAGCAAAATGCTCATTTTTTCGGTGTAACAATTAGTGACGAACAAGCAGAAGCAGGGATTGTA
GTAAGAGCTACTTCAGCTGCCCAAAGCAAATTCAAGCTACTATATTTTGAACATGATGTGAGTGGGGGTTACGGCCTGGCCTTGCAGGAA
GATAGTGAAAAAGCAGGCAAGGTAACCTCCGCAGGAATGTATTTCTTGCACTTTCAAGTGTACAGAATGGATTCAACTGTAAATGCGGTA
TGTGGATTCATCTTaGTGGTTAAAATTCAATAGTATTGCATGCAGTGTTATCAAAAGTGATAATACTCGTGATGATGtAGTTAGCAATGG
CCAAAGATCCTGAAGCTGCTTTCTTTAAGAGGCTGGAGGGTCTTCAACCTTGTGAGGTCTCACAACTAAATGCCGGCACTCACATATTTG
CTGTTTATGGAGATAATTTCTTTAAGCCTGCTAGTTATACTATTGAGGCTCTGTGTGCCCAGACATACGAGGATACAACT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan