ESTScan Details for Unigene SGN-U318500

Score 
61
Direction 
Forward
Predicted Peptide Sequence 
MGLQNQLSDVSTESIPILLVTLLANCIANLRSIIFTFLQFIGVSVNPIQIEENAIYDAVGSGLAGVVMLAEQLNLNRMFSYAFDDQSAGS
AAVFCLNRLIDGENVRKLDCKHVFHKACFDGWLDTFNFNCPICRSSLSVVSDERXGGHATAVAWDVIXVVLVEVKLCESELXINERHKNF
DKRLA
Predicted Coding Sequence 
ATGGGATTACAAAATCAATTAAGTGATGTTTCTACTGAATCCATTCCTATTTTGCTCGTAACTCTTCTCGCTAATTGCATCGCTAATCTC
CGTTCGATCATCTTCACTTTTCTTCAGTTCATCGGCGTTTCAGTAAATCCGATTCAAATCGAAGAAAATGCGATTTACGATGCGGTTGGT
TCAGGTTTAGCCGGAGTCGTTATGCTGGCTGAACAGCTTAATTTGAATCGGATGTTCTCGTATGCATTTGACGATCAATCTGCTGGTTCA
GCTGCXGTTTTTTGCTTGAATCGATTAATTGATGGTGAAAATGTGAGGAAATTGGATTGTAAGCATGTTTTTCATAAGGCGTGTTTTGAT
GGATGGTTAGATACGTTTAATTTTAACTGTCCGATTTGCCGGTCGTCGTTATCGGTCGTTTCCGATGAGCGCGXTGGAGGTCACGCGACG
GCGGTTGCATGGGATGTGATTGAXGTGGTTCTCGTTGAGGTGAAATTATGCGAATCAGAACTTCXGATAAACGAGAGGCATAAAAACTTC
GATAAACGATTGGCATAA
Edits in Original Sequence 
CGGCCAAATCGGCCGAATTGATTAACATAAAAATCATTGATAAAAAAA(5')ATGGGATTACAAAATCAATTAAGTGATGTTTCTACTGA
ATCCATTCCTATTTTGCTCGTAACTCTTCTCGCTAATTGCATCGCTAATCTCCGTTCGATCATCTTCACTTTTCTTCAGTTCATCGGCGT
TTCAGTAAATCCGATTCAAATCGAAGAAAATGCGATTTACGATGCGGTTGGTTCAGGTTTAGCCGGAGTCGTTATGCTGGCTGAACAGCT
TAATTTGAATCGGATGTTCTCGTATGCATTTGACGATCAATCTGCTGGTTCgAGCTGCXGTTTTTTGCTTGAATCGATTAATTGATGGTG
AAAATGTGAGGAAATTGGATTGTAAGCATGTTTTTCATAAGGCGTGTTTTGATGGATGGTTAGATACGTTTAATTTTAACTGTCCGATTT
GCCGGTCGTCGTTATCGGTCGTTTCCGATGAGCGCGXTGGAGGTCACGCGACGGCGcGTTGCATGGGATGTGATTGAXGTGGTTCTCGTT
GAGGTGAAATTATGCGAATCAGAACTTCXGATAAACGAGAGGCATAAAAACTTCGATAAACGATTGGCATAA(3')GTATCACGAGGTGT
GAAGGAGATCAACTAATACAATCTGTGTGTTGGTGAAAATGAGTGATGAATTTCACCAGGAGTTCTTTGTTTTGTTTTTTTTTTTTCAAA
AAAAAAAATTGAAATTATTTTTTGAGGAATTATTTCCGGTTTTTGAAAAGCTTAATATAAAGTTCTTTTTGCTCACGTAAAAAAAAAAAA
TTTTTGGGGGAAATAAAATATTATTTTCCAAAAAGTTAAATTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan