ESTScan Details for Unigene SGN-U318794

Score 
995
Direction 
Forward
Predicted Peptide Sequence 
MVREKHKPLKLYQVWKGSNKFLLGGRLIFGPDVSSLFLSTLLIAGPALAFCIKVSCVIRHRIREHKDAGPWYPILVIGAVLTIMDIVFLF
LTSSRDPGIVPRNITPPESDETFDIHTPSMEWVNGRTPHLKLPRAKDVIVNGHTVKVKYCDXMFAVPALLVPLIVRSATIVFKDLIITVP
GLANALGFGITDSSTCSYLHQLYYAYMSLSYPWXNILHRGGNLWRAISQDILSDVLIIYCFIAVWFVGGLTIFHFYLISTNQTTYENFRY
RYDKKENPYNRGSIENIKEVFFSKIPPSLNNFRAVFKENDIVMVEPTTSNFVGNIHSSKEKIDIEMGTMFPEDSGLSLPEILRNLEYEEI
DDTLKSREWTRDAYSDSGEQMRSITSLKETIDTEVGDNFAEDKGTAQAEISQNMNGDSMEKNFKNKDEGGRTDYEPFWFSLEQEKESVKS
STLGSASNVEENSEEVSSSALYMTPINDRSPKV
Predicted Coding Sequence 
ATGGTTCGTGAGAAACATAAACCTCTGAAGCTTTATCAGGTTTGGAAGGGTAGTAATAAATTCTTATTGGGAGGAAGATTGATCTTCGGT
CCGGATGTGTCATCATTGTTTCTATCAACACTTTTGATTGCTGGCCCAGCACTTGCTTTTTGTATAAAAGTCTCTTGTGTAATCAGACAT
CGTATCAGAGAGCACAAAGATGCTGGTCCTTGGTATCCTATACTTGTAATTGGAGCAGTTCTTACTATTATGGATATTGTTTTTCTCTTT
TTAACATCTAGTAGAGATCCTGGAATTGTCCCACGAAACATAACTCCTCCTGAATCTGACGAAACATTTGATATACATACCCCTTCCATG
GAGTGGGTCAACGGTAGAACTCCTCATTTGAAACTTCCACGAGCAAAAGATGTAATCGTGAATGGACACACAGTTAAAGTCAAGTACTGT
GATXACATGTTTGCTGTACCGGCXCTCCTCGTTCCTCTCATTGTTCGATCTGCAACAATTGTGTTCAAAGATTTGATCATCACTGTCCCT
GGGTTGGCCAATGCATTGGGCTTCGGAATTACAGATTCTTCTACTTGTTCATATCTACATCAACTATATTATGCATATATGTCTTTGTCA
TATCCTTGGXTCAATATCCTTCATCGTGGCGGCAACTTATGGAGAGCTATTTCACAAGATATCTTGTCAGATGTTCTCATTATATACTGC
TTCATTGCTGTTTGGTTTGTTGGTGGCCTTACTATTTTCCATTTTTACCTGATTAGCACTAACCAGACTACTTATGAGAACTTCAGGTAT
CGATATGATAAGAAGGAGAATCCCTATAATAGGGGGTCAATTGAAAATATCAAAGAAGTTTTCTTTTCCAAGATCCCACCCTCCTTGAAT
AATTTTCGAGCAGTTTTTAAAGAAAATGACATTGTAATGGTTGAGCCAACAACTTCCAACTTTGTGGGAAATATCCATAGCTCAAAAGAG
AAGATAGATATTGAGATGGGAACAATGTTTCCAGAGGATAGTGGCCTATCACTTCCTGAAATTTTGCGGAATTTGGAATATGAGGAGATA
GATGATACTTTAAAAAGCAGGGAATGGACCAGAGATGCTTATTCTGATTCTGGTGAGCAAATGCGGAGCATCACCAGCTTAAAGGAGACA
ATTGATACTGAGGTGGGAGATAACTTTGCAGAAGATAAAGGAACTGCACAGGCAGAAATTTCGCAGAATATGAATGGCGATAGCATGGAG
AAAAATTTCAAAAACAAGGATGAAGGTGGGAGAACTGATTATGAACCTTTCTGGTTTTCACTTGAACAAGAAAAAGAAAGTGTAAAGAGC
TCCACTCTAGGAAGTGCATCTAATGTAGAAGAGAACTCAGAAGAAGTAAGTAGCTCGGCTCTGTATATGACACCAATAAATGATCGTAGC
CCAAAGGTATAG
Edits in Original Sequence 
GGAATATTGTTGGAGAGAGAGAAAAGGGGGAGAGAGAAAATTAGAGATAGGGGGAAAATCCATTCTGGGTAAATCCGTCTGAGACAAACA
ACAACAACAAAGGCAGCTAGTTCTTGATCACCACTTCGTTCCCAACAACAAAAAGATTCTCTTTTTCTCTCCCTTTTGTTCTCCAAACCC
CATTTCTTTAAACTCTTTGAATTGGGGATTTTCTTGATTTTTTTTTGAGAAAAAGACAATCTTTTTCTGTATTTGGACTTTTTTCTTTAT
AAGGGATGTTGGAAGTTGTTTAATAGGAAGAGAAGGGGAGGATTTTGATTCTTATTTGGGATTGGAAAGTTGGAATTTTTGGGTTGTTTT
TGTTTCATTTCAAATTTTCAGAGTT
(5')ATGGTTCGTGAGAAACATAAACCTCTGAAGCTTTATCAGGTTTGGAAGGGTAGTAATAAAT
TCTTATTGGGAGGAAGATTGATCTTCGGTCCGGATGTGTCATCATTGTTTCTATCAACACTTTTGATTGCTGGCCCAGCACTTGCTTTTT
GTATAAAAGTCTCTTGTGTAATCAGACATCGTATCAGAGAGCACAAAGATGCTGGTCCTTGGTATCCTATACTTGTAATTGGAGCAGTTC
TTACTATTATGGATATTGTTTTTCTCTTTTTAACATCTAGTAGAGATCCTGGAATTGTCCCACGAAACATAACTCCTCCTGAATCTGACG
AAACATTTGATATACATACCCCTTCCATGGAGTGGGTCAACGGTAGAACTCCTCATTTGAAACTTCCACGAGCAAAAGATGTAATCGTGA
ATGGACACACAGTTAAAGTCAAGTACTGTGATXACATGTTTGCTGTACCGGCXCTCCTCGTTCCTCTCATTGTTCGATCTGCAACAATTG
TGTTCAAAGATTTGATCATCACTGTCCCTGGGTTGGCCAATGCATTGGGCTTCGGAATTACAGATTCTTCTACTTGTTCATATCTACATC
AACTATATTATGCATATATGTCTTTGTCATATCCTTGGXTCAATATCCTTCATCGTGGCGGCAACTTATGGAGAGCTATTTCACAAGATA
TCTTGTCAGATGTTCTCATTATATACTGCTTCATTGCTGTTTGGTTTGTTGGTGGCCTTACTATTTTCCATTTTTACCTGATTAGCACTA
ACCAGACTACTTATGAGAACTTCAGGTATCGATATGATAAGAAGGAGAATCCCTATAATAGGGGGTCAATTGAAAATATCAAAGAAGTTT
TCTTTTCCAAGATCCCACCCTCCTTGAATAATTTTCGAGCAGTTTTTAAAGAAAATGACATTGTAATGGTTGAGCCAACAACTTCCAACT
TTGTGGGAAATATCCATAGCTCAAAAGAGAAGATAGATATTGAGATGGGAACAATGTTTCCAGAGGATAGTGGCCTATCACTTCCTGAAA
TTTTGCGGAATTTGGAATATGAGGAGATAGATGATACTTTAAAAAGCAGGGAATGGACCAGAGATGCTTATTCTGATTCTGGTGAGCAAA
TGCGGAGCATCACCAGCTTAAAGGAGACAATTGATACTGAGGTGGGAGATAACTTTGCAGAAGATAAAGGAACTGCACAGGCAGAAATTT
CGCAGAATATGAATGGCGATAGCATGGAGAAAAATTTCAAAAACAAGGATGAAGGTGGGAGAACTGATTATGAACCTTTCTGGTTTTCAC
TTGAACAAGAAAAAGAAAGTGTAAAGAGCTCCACTCTAGGAAGTGCATCTAATGTAGAAGAGAACTCAGAAGAAGTAAGTAGCTCGGCTC
TGTATATGACACCAATAAATGATCGTAGCCCAAAGGTATAG(3')CATACACATTATAAGGAACTCTCCCTTGAGTCTTTTGTGTTTACC
TAGTGGCAGCTTGGGAACACTTGACCAAGATTCGCGGCTTTTCAAATTATCATGTTCAAGATCAGCAACATATGGAAAAAATTATGTTTG
AAATAATGCAGGGTCTTGCTTGAGATGAGAGCAGATCATGTTGGAGTTCAACATTGTAGATAGATTGATCAGTAGCTCCTTTCTTTGTTC
ATCCTTTTGTCCAATTCCATCCAAGTCTTTTTTCATTCTCTTACAAAGTCAGTGTGCATAGTTTATGTATCATGTGAAGCTTCTGGTTTG
ATAGAAAATTTATTGGATAAACAAATAGATAGATTCTTTTCTGTAAATTTGATTTTTGCAGCTTCTTATCCCTGATTTGTTTTCTATTGG
TATGGTTTGTTTAATTTTCTTTTTTGAATTGGTCTCATGATAAATACCAAAGGAGTTTGAGTATTGAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan