ESTScan Details for Unigene SGN-U318820

Score 
1162
Direction 
Forward
Predicted Peptide Sequence 
MGFHHIIIIRFVFSILLGWLSSSVEATNSTKCNQYCGAAGSYSPRVSYPFGFSEGCGIRLDCTESTGEIRIGEYIIQNVTSETLMVNFSM
NCSRPIEDLQQFDRTNFGMTWRNGLLLHNCKVPKSECTIPSEILSTRLNIQSCDSKKENVSCYSEARADYLDYQKLKNTGCGTVISSILI
GMDNDTMKSSAMFIEFQTMELAWGLEGDCACHNDANCTNFLSRGTEKVSGAGVKMDSSVMASATVMAAGKFQDVILPDTSLDDXGGTTRI
GVLVGGIIAGAGLMAALAVLCYCIRRRSASLKKRMSARRLLSEAAGSNSVHVFQYKEIERATNSFSEKQRLGIGAYGTVYAGKLHSDEWV
AIKKLRHRDPDGVEQVMNEVKLLSSVSHPNLVRLLGCCIENGEQILVYEFMPNGTLAQHLQRERSSGLPWTIRLTIATETAHAIAHLHSA
MNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMTDDSHISTAPQGTPGYVDPQYHQNYHLSDKSDVYSFGVVLVEIITAMKVVISLDH
TXEINLAALAIDRIGKGRVDEIIDPFLEPHRDAWTLSSVHRVAELAFRCLAFHRDMRPSMTEVADELEQIRLSSWASLEDNVCMTSSVNS
SCSSPRSMSETSFRSTTTKKGVGSRRLIVPQKIANSLAIMEEIKDSSPVSVQDPWLSEESPPSTNRLLGNSGR
Predicted Coding Sequence 
ATGGGTTTTCATCACATCATTATTATTAGATTCGTTTTCTCAATTTTATTGGGTTGGTTATCATCGTCAGTTGAGGCTACTAATTCAACT
AAGTGCAATCAGTACTGTGGAGCTGCTGGTTCTTATAGTCCGCGTGTTTCGTATCCATTTGGATTCTCAGAGGGTTGTGGGATTCGTTTA
GACTGTACTGAAAGTACTGGAGAAATCAGAATTGGGGAATATATAATACAGAATGTGACTTCAGAGACTCTGATGGTTAACTTCTCGATG
AATTGCAGCCGTCCGATTGAGGATCTACAGCAATTTGATCGAACCAACTTTGGTATGACTTGGAGAAATGGACTGCTTCTACACAATTGC
AAAGTACCGAAGAGCGAATGTACCATACCATCGGAAATTTTAAGCACGCGTTTGAACATACAGTCATGTGATTCGAAGAAGGAGAATGTC
AGTTGTTATTCTGAGGCGAGGGCGGATTATTTAGATTACCAGAAATTGAAGAATACAGGGTGTGGAACTGTGATTTCGTCCATCTTGATT
GGTATGGATAATGATACAATGAAGAGTTCTGCCATGTTTATCGAGTTTCAGACGATGGAATTAGCGTGGGGATTGGAAGGGGATTGTGCA
TGTCATAACGATGCAAATTGTACCAACTTTCTCTCCCGGGGAACCGAAAAGGTTTCCGGTGCCGGTGTAAAGATGGATTCGTCGGTGATG
GCTTCAGCGACGGTGATGGCTGCCGGAAAGTTTCAAGATGTAATCCTTCCAGATACCTCTCTGGACGATGXTGGTGGAACTACCAGAATT
GGTGTGCTCGTTGGAGGGATTATTGCTGGAGCTGGTTTAATGGCTGCTTTGGCTGTTCTTTGCTACTGCATTCGAAGACGTTCTGCATCT
CTCAAGAAAAGAATGAGCGCAAGACGCCTTCTCTCTGAAGCTGCAGGCAGCAACAGTGTTCATGTATTTCAATACAAAGAAATTGAGAGA
GCAACAAATAGTTTCTCTGAGAAACAGAGGCTGGGCATAGGGGCTTATGGCACAGTTTATGCTGGAAAGCTCCACAGTGATGAATGGGTT
GCAATTAAGAAACTAAGACACCGGGATCCGGATGGTGTTGAACAAGTGATGAATGAGGTTAAGCTTTTGTCTTCTGTAAGTCATCCAAAC
TTAGTCCGCCTCTTGGGTTGTTGTATAGAAAATGGTGAACAGATTCTTGTTTATGAATTTATGCCCAACGGAACTCTAGCTCAGCATCTA
CAGAGAGAAAGGAGTTCAGGACTTCCGTGGACAATACGTCTCACTATCGCAACAGAAACTGCTCATGCGATTGCTCACCTTCACTCAGCA
ATGAATCCACCAATATACCACAGGGATATCAAATCAAGTAACATACTATTGGATTACAACTTCAACTCAAAAGTTGCAGACTTTGGTCTT
TCCAGATTTGGCATGACAGATGATTCCCACATTTCTACAGCACCACAAGGTACTCCAGGTTATGTGGATCCTCAGTACCATCAGAATTAC
CATCTTTCCGATAAGAGTGATGTGTACAGCTTCGGGGTGGTTCTTGTAGAAATCATTACAGCAATGAAAGTGGTGATTTCTCTAGATCAC
ACAGXTGAGATTAATTTGGCTGCACTTGCAATAGACAGAATAGGTAAGGGTCGTGTGGATGAGATCATCGATCCATTTCTAGAGCCACAC
AGAGATGCATGGACTCTATCATCAGTTCATAGAGTTGCAGAGCTTGCTTTTAGATGCCTTGCATTTCATAGGGATATGAGGCCTTCAATG
ACAGAAGTGGCAGACGAGCTGGAACAGATCAGGCTCAGCAGTTGGGCATCATTGGAGGACAATGTATGCATGACTTCATCAGTGAATTCC
TCTTGCTCATCTCCCCGTAGTATGAGTGAGACATCTTTTCGTAGTACAACAACTAAGAAAGGAGTAGGGAGTAGGAGGTTGATTGTTCCC
CAGAAGATAGCGAATTCACTGGCAATCATGGAGGAAATAAAAGACAGTTCCCCTGTTTCTGTACAGGATCCTTGGTTAAGTGAAGAGAGT
CCCCCTTCAACAAATCGATTATTAGGTAATTCTGGTCGATGA
Edits in Original Sequence 
CCTTCGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTAGAAAGCGTGTGCGTAAAAAGAAGCTTCTTCCCGTCTCTTCCATCTC
CGATTACTAGTCGATAGCTTTACTGTTACGAAACCCTGTTTTTGCAGAGCTGTTTTGGAGTTGAGATATTTCAAATTTTGGACTCTTAAT
TGCTGCTATTTTGCTTCCAATCAAAGAAAAGAAAAGTTGCAGACGAAGGAAGAGAGAGAAGTAAAAGACATTAATACATGAAACCAGTCC
ACGAAGCAGATGATTGTTCACTTTAATTCAATTTCGAGTC
(5')ATGGGTTTTCATCACATCATTATTATTAGATTCGTTTTCTCAATTT
TATTGGGTTGGTTATCATCGTCAGTTGAGGCTACTAATTCAACTAAGTGCAATCAGTACTGTGGAGCTGCTGGTTCTTATAGTCCGCGTG
TTTCGTATCCATTTGGATTCTCAGAGGGTTGTGGGATTCGTTTAGACTGTACTGAAAGTACTGGAGAAATCAGAATTGGGGAATATATAA
TACAGAATGTGACTTCAGAGACTCTGATGGTTAACTTCTCGATGAATTGCAGCCGTCCGATTGAGGATCTACAGCAATTTGATCGAACCA
ACTTTGGTATGACTTGGAGAAATGGACTGCTTCTACACAATTGCAAAGTACCGAAGAGCGAATGTACCATACCATCGGAAATTTTAAGCA
CGCGTTTGAACATACAGTCATGTGATTCGAAGAAGGAGAATGTCAGTTGTTATTCTGAGGCGAGGGCGGATTATTTAGATTACCAGAAAT
TGAAGAATACAGGGTGTGGAACTGTGATTTCGTCCATCTTGATTGGTATGGATAATGATACAATGAAGAGTTCTGCCATGTTTATCGAGT
TTCAGACGATGGAATTAGCGTGGGGATTGGAAGGGGATTGTGCATGTCATAACGATGCAAATTGTACCAACgTTTCTCTCCCGGGGAACC
GAAAAGGTTTCCGGTGCCGGTGTAAAGATGGATTCGTCGGTGATGGCTTCAGCGACGGTGATGGCTGCCGGAAAGTTTCAAGATGTAATC
CTTCCAGATACCTCTCTGGACGATGXTGGTGGAACTACCAGAATTGGTGTGCTCGTTGGAGGGATTATTGCTGGAGCTGGTTTAATGGCT
GCTTTGGCTGTTCTTTGCTACTGCATTCGAAGACGTTCTGCATCTCTCAAGAAAAGAATGAGCGCAAGACGCCTTCTCTCTGAAGCTGCA
GGCAGCAACAGTGTTCATGTATTTCAATACAAAGAAATTGAGAGAGCAACAAATAGTTTCTCTGAGAAACAGAGGCTGGGCATAGGGGCT
TATGGCACAGTTTATGCTGGAAAGCTCCACAGTGATGAATGGGTTGCAATTAAGAAACTAAGACACCGGGATCCGGATGGTGTTGAACAA
GTGATGAATGAGGTTAAGCTTTTGTCTTCTGTAAGTCATCCAAACTTAGTCCGCCTCTTGGGTTGTTGTATAGAAAATGGTGAACAGATT
CTTGTTTATGAATTTATGCCCAACGGAACTCTAGCTCAGCATCTACAGAGAGAAAGGAGTTCAGGACTTCCGTGGACAATACGTCTCACT
ATCGCAACAGAAACTGCTCATGCGATTGCTCACCTTCACTCAGCAATGAATCCACCAATATACCACAGGGATATCAAATCAAGTAACATA
CTATTGGATTACAACTTCAACTCAAAAGTTGCAGACTTTGGTCTTTCCAGATTTGGCATGACAGATGATTCCCACATTTCTACAGCACCA
CAAGGTACTCCAGGTTATGTGGATCCTCAGTACCATCAGAATTACCATCTTTCCGATAAGAGTGATGTGTACAGCTTCGGGGTGGTTCTT
GTAGAAATCATTACAGCAATGAAAGTGGTGATTTCTCTAGATCACACAGXTGAGATTAATTTGGCTGCACTTGCAATAGACAGAATAGGT
AAGGGTCGTGTGGATGAGATCATCGATCCATTTCTAGAGCCACACAGAGATGCATGGACTCTATCATCAGTTCATAGAGTTGCAGAGCTT
GCTTTTAGATGCCTTGCATTTCATAGGGATATGAGGCCTTCAATGACAGAAGTGGCAGACGAGCTGGAACAGATCAGGCTCAGCAGTTGG
GCATCATTGGAGGACAATGTATGCATGACTTCATCAGTGAATTCCTCTTGCTCATCTCCCCGTAGTATGAGTGAGACATCTTTTCGTAGT
ACAACAACTAAGAAAGGAGTAGGGAGTAGGAGGTTGATTGTTCCCCAGAAGATAGCGAATTCACTGGCAATCATGGAGGAAATAAAAGAC
AGTTCCCCTGTTTCTGTACAGGATCCTTGGTTAAGTGAAGAGAGTCCCCCTTCAACAAATCGATTATTAGGTAATTCTGGTCGATGA(3')
TGACTTGAAAAAAGAAGTTCGCTCTAGGTAGAAAACTGAGGGGGATCACCTGTAATCTATCACCTCCTTTTCCTGCCTTCTAATCTACT
GAGAATATCAAAGAGTATTATTAGAGCACTTCTCTTTGTATCAAAATTTTTATTGCTTCATACGCAGAATATAGAATGTGAAATAGTATT
TGCAATGCCCTGGCCAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan