ESTScan Details for Unigene SGN-U318832

Score 
535
Direction 
Forward
Predicted Peptide Sequence 
MGGCCCSSRKPPQLHGTQVFYYFPPASEEYESLTSDDSAAIAFTSELLDDLNVDRSTPDTYRSPPAPIPFEVDLGHPQSRGGSQFIDETL
LQRSYEITNCKDIKFSDRKAETESLLASLKKAGIDLVKSNPSIIKSAEEEDVCPTCLEEYDVDNPRIVSKCNHHFHLSCILGGWKEVKHA
QYAIRKWYTKLYEXLIKSSLDAGRQHEAVVFHLAAWPVFTCSLMKVKFSMYMKLTLVNPALDEDASCIYMLMGVNLRAKNKKTSCSFAFG
AWKIKF
Predicted Coding Sequence 
ATGGGTGGTTGCTGTTGCTCTTCAAGGAAGCCTCCCCAGCTTCATGGAACACAAGTATTTTACTATTTTCCTCCAGCTTCTGAAGAGTAT
GAGTCCCTGACATCTGATGATAGTGCTGCTATTGCATTTACCTCTGAGCTCCTGGATGATTTAAACGTAGATAGATCAACACCCGACACT
TACCGCTCTCCCCCTGCACCAATTCCATTTGAAGTAGATTTGGGGCATCCACAGTCAAGAGGAGGTTCCCAGTTCATAGATGAAACATTA
CTTCAACGTAGCTATGAGATAACTAATTGTAAAGATATTAAGTTTTCTGATCGCAAAGCTGAAACAGAGTCTCTTCTTGCCTCCCTAAAG
AAAGCAGGGATTGACCTTGTAAAATCTAATCCATCTATTATTAAATCAGCAGAAGAAGAGGATGTTTGTCCTACTTGTCTTGAAGAATAT
GATGTCGACAATCCAAGAATAGTCTCAAAATGTAACCACCATTTTCATCTTTCATGCATTCTTGGTGGATGGAAAGAAGTCAAACATGCC
CAATATGCGATCAGGAAATGGTATACGAAGCTCTATGAAAXACTAATTAAAAGTTCCTTAGATGCTGGTCGTCAACATGAGGCTGTTGTT
TTTCACTTGGCGGCTTGGCCTGTATTCACTTGTTCACTCATGAAAGTGAAATTCTCTATGTATATGAAGCTTACGTTGGTAAATCCCGCC
CTTGATGAAGATGCGAGTTGCATATATATGCTGATGGGAGTTAATTTGCGGGCGAAGAACAAAAAAACAAGTTGTAGTTTTGCATTTGGT
GCCTGGAAGATTAAATTCTGA
Edits in Original Sequence 
AAACACAATAAAAAAAGAATCTTTAGCAAGGAAGGTTTTTTTTTTTTCTTGAATTGTCCCTCTTCATACAGACGGAGAAGGTAATGTGTT
GGGAAATAAGACATATACTTGGATAACTAAAACATCTGCAAG
(5')ATGGGTGGTTGCTGTTGCTCTTCAAGGAAGCCTCCCCAGCTTCA
TGGAACACAAGTATTTTACTATTTTCCTCCAGCTTCTGAAGAGTATGAGTCCCTGACATCTGATGATAGTGCTGCTATTGCATTTACCTC
TGAGCTCCTGGATGATTTAAACGTAGATAGATCAACACCCGACACTTACCGCTCTCCCCCTGCACCAATTCCATTTGAAGTAGATTTGGG
GCATCCACAGTCAAGAGGAGGTTCCCAGTTCATAGATGAAACATTACTTCAACGTAGCTATGAGATAACTAATTGTAAAGATATTAAGTT
TTCTGATCGCAAAGCTGAAACAGAGTCTCTTCTTGCCTCCCTAAAGAAAGCAGGGATTGACCTTGTAAAATCTAATCCATCTATTATTAA
ATCAGCAGAAGAAGAGGATGTTTGTCCTACTTGTCTTGAAGAATATGATGTCGACAATCCAAGAATAGTCTCAAAATGTAACCACCATTT
TCATCTTTCATGCATTCTTGaGTGGATGGAAAGAAGTCAAACATGCCCAATATGCGATCAGGAAATGGTATACGAAGCTCTATGAAAXAC
TAATTAAAAGTTCCTTAGATGCTGGTCGTCAACATGAGGCTGTTGTTTTTCACTTGGCGGCTTGGCCTGTATTCACTTGTTCACTCATGA
AAGTGtAAATTCTCTATGTATATGAAGCTTACGTTGGTAAATCCCGCCCTTGATGAAGATGCGAGTTGCATATATATGCTGATGGGAGTT
AATTTGCGGGCGAAGAACAAAAAAACAAGTTGTAGTTTTGCATTTGGTGCCTGGAAGATTAAATTCTGA(3')AAACGCGTCTTTTTGGT
CATGATTCTTCTGAGTTCCAAGTGTTGTACAGTGAACCCTTTTGGTGGTTGTAATTTTATGTTCAATTGCTGTACAGATTCTTCTGTCAA
AGATTATGGCAATGGCATAGTCATTAAAGTTTCATAGATTCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan