ESTScan Details for Unigene SGN-U318918

Score 
621
Direction 
Forward
Predicted Peptide Sequence 
QIKQDFGGVSRVSLPNSSLVSMAARSIFLKLTRNARGREKSLFRSFTTTEVVYEDSPNSSEEERGEIPDDXEEQNIQPKTTQKKPTNVLQ
RWVGEGXSNIYLRPPSHLQRASKVAQIQAALEISEWLVYHNQDEALDSDYAIRIDLMTKIFGIDSAERYFEGLPTTVKTTETCTALLHSY
ASLRLTEKAEDLYERMKEANLSLNTVTYNEMMTLYMSVGQLEKVPLIVEEMKLQKVAPDLFTYNLWVSSCAAALNIDEVRRILDEISRGS
DSGEQWIRYMNLVNIYITSGNLVNSGLNSVVESEKGITQREWISYDFLIILYGALGNNEKLDQIWKSLRMTNQKMTSRNYVCILSSYLML
GHMKEAGEIIDQWKLSAATAFDRSSCNRLLKAYKEVGLEESAVAFRLLLIQKGCDEIEEXIVAGPCDRTPAAFHVAV
Predicted Coding Sequence 
XXCCAAATTAAACAAGACTTTGGAGGGGTTTCTCGGGTTTCTCTTCCCAATTCATCTCTAGTTTCCATGGCTGCTCGCAGTATCTTCCTC
AAACTCACGAGAAATGCCCGTGGCAGAGAAAAGAGTCTATTTAGATCCTTTACTACAACTGAAGTTGTCTATGAAGACTCCCCAAATTCT
TCTGAGGAAGAAAGGGGCGAAATCCCAGATGATXTTGAAGAGCAGAATATTCAGCCTAAGACTACCCAAAAGAAGCCCACCAACGTGCTT
CAGAGATGGGTCGGTGAAGGCCXGAGTAATATCTATCTCCGACCTCCGTCACATCTCCAAAGAGCTTCGAAAGTCGCGCAGATTCAAGCA
GCCCTTGAGATCTCAGAATGGCTGGTTTACCACAATCAGGATGAAGCATTGGACTCAGATTATGCTATCCGCATTGACTTGATGACCAAA
ATTTTTGGAATTGATTCTGCTGAACGGTATTTTGAAGGACTGCCTACCACTGTAAAAACCACTGAAACATGTACTGCTCTCCTCCACTCC
TATGCTAGTTTGAGACTAACTGAGAAGGCTGAAGACCTCTATGAGAGAATGAAAGAAGCAAATCTTTCTCTAAATACTGTCACGTATAAT
GAAATGATGACTTTGTACATGTCTGTTGGACAGCTCGAGAAAGTACCTCTTATTGTTGAGGAGATGAAACTTCAAAAGGTTGCACCAGAC
CTATTTACTTACAATCTGTGGGTAAGTTCATGTGCTGCAGCTCTAAACATTGACGAGGTTAGACGGATTCTTGATGAAATAAGTCGGGGC
TCTGACTCTGGTGAACAGTGGATAAGATACATGAACCTTGTTAACATATACATCACCTCAGGTAACCTTGTAAACTCAGGGTTGAACTCT
GTAGTTGAATCTGAGAAGGGTATCACACAAAGAGAATGGATATCATATGACTTCCTTATTATTCTCTATGGTGCATTGGGAAATAATGAA
AAGCTTGATCAAATTTGGAAATCCTTGCGGATGACTAATCAAAAAATGACGAGCAGAAATTATGTCTGCATACTTTCATCATATCTCATG
CTTGGGCATATGAAGGAAGCTGGAGAAATTATCGATCAGTGGAAGCTTTCTGCAGCGACAGCTTTTGATCGTTCCAGCTGCAATAGACTT
CTAAAAGCATATAAAGAAGTTGGGTTGGAAGAGAGTGCAGTAGCTTTCCGGCTGCTTCTAATTCAGAAAGGTTGTGATGAAATAGAGGAA
XTCATAGTAGCAGGACCATGCGATCGAACGCCTGCAGCATTTCATGTGGCAGTATAG
Edits in Original Sequence 
(5')XXCCAAATTAAACAAGACTTTGGAGGGGTTTCTCGGGTTTCTCTTCCCAATTCATCTCTAGTTTCCATGGCTGCTCGCAGTATCTT
CCTCAAACTCACGAGAAATGCCCGTGGCAGAGAAAAGAGTCTATTTAGATCCTTTACTACAACTGAAGTTGTCTATGAAGACTCCCCAAA
TTCTTCTGAGGAAGAAAGGGGCGAAATCCCAGATGATXTTGAAGAGCAGAATATTCAGCCTAAGACTACCCAAAAGAAGCgCCACCAACG
TGCTTCAGAGATGGGTCGGTGAAGGCCXGAGTAATATCTATCTCCGACCTCCGTCACATCTCCAAAGAGCTTCGAAAGTCGCGCAGATTC
AAGCAcGCCCTTGAGATCTCAGAATGGCTGGTTTACCACAATCAGGATGAAGCATTGGACTCAGATTATGCTATCCGCATTGACTTGATG
ACCAAAATTTTTGGAATTGATTCTGCTGAACGGTATTTTGAAGGACTGCCTACCACTGTAAAAACCACTGAAACATGTACTGCTCTCCTC
CACTCCTATGCTAGTTTGAGACTAACTGAGAAGGCTGAAGACCTCTATGAGAGAATGAAAGAAGCAAATCTTTCTCTAAATACTGTCACG
TATAATGAAATGATGACTTTGTACATGTCTGTTGGACAGCTCGAGAAAGTACCTCTTATTGTTGAGGAGATGAAACTTCAAAAGGTTGCA
CCAGACCTATTTACTTACAATCTGTGGGTAAGTTCATGTGCTGCAGCTCTAAACATTGACGAGGTTAGACGGATTCTTGATGAAATAAGT
CGGGGCTCTGACTCTGGTGAACAGTGGATAAGATACATGAACCTTGTTAACATATACATCACCTCAGGTAACCTTGTAAACTCAGGGTTG
AACTCTGTAGTTGAATCTGAGAAGGGTATCACACAAAGAGAATGGATATCATATGACTTCCTTATTATTCTCTATGGTGCATTGGGAAAT
AATGAAAAGCTTGATCAAATTTGGAAATCCTTGCGGATGACTAATCAAAAAATGACGAGCAGAAATTATGTCTGCATACTTTCATCATAT
CTCATGCTTGGGCATATGAAGGAAGCTGGAGAAATTATCGATCAGTGGAAGCTTTCTGCAGCGACAGCTTTTGATCGTTCCAGCTGCAAT
AGACTTCTAAAAGCATATAAAGAAGTTGGGTTGGAAGAGAGTGCAGTAGCTTTCCGGCTGCTTCTAATTCAGAAAGGTTGTGATGAAATA
GAGGAAXTCATAGTAGCAGGACCATGCGATCGAACGCCTGcCAGCATTTCATGTGGCAGTATAG(3')AGAAAGAAATAAACAATGCCAA
TGAAGTAGTAATTTCATGTGTACTGAATTTTGCTACTGTAAAATTGGCAGGTCATAGTAAGTCCTTTTCTGTTTGTTTGCTGCGACTCTA
TTAGAAAAGTTGTGCAGCTATTCAGGACTTTATATTCTATTTAGCAAGCCTTATGACTAATTATTTGGAATAACTGATTGACATCTTTCC
TTTCCCAATTATTCGACGATAAGGGTCTATTTGGAAAGGCACTCGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan