ESTScan Details for Unigene SGN-U318986

Score 
769
Direction 
Forward
Predicted Peptide Sequence 
GGTPLYAQCTTLNAEESEEIQECIVAVGSPPISFERTLRIRGKNNPSRSDFSAXDLFVRVIAXVELVMANDDDFTFCQVGAPDNQDYVDT
QKIAHDISEIRIKDEPSNNDGTSQSNGAPWEGKLGNITTSKKQGTVGSLSFTVIDTSPGKQASRTSGQVALKDGGFSVPTYQKEIKPARK
PVVRAKVPYEKGYSQMDWLKLTRTHPDLAGLNGQSNRRLISMDEVKEHQNAEAMWTVLKGHVYNITPYMKFHPGGVDMLMKAVGKDCTAL
FNKYHAWVNAEVLMEKCLVGILDDSK
Predicted Coding Sequence 
XTTGGTGGTACTCCTCTTTATGCACAATGTACCACTCTAAATGCAGAGGAATCAGAAGAAATTCAAGAATGTATCGTAGCXGTAGGTAGT
CCGCCCATCAGCTTTGAACGAACATTGCGAATTAGAGGGAAAAACAACCCCTCAAGATCAGATTTCTCGGCGAXGGACCTTTTTGTTCGT
GTCATTGCTXCAGTTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGAGCACCTGATAATCAAGATTATGTGGAT
ACACAGAAGATTGCTCATGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTAATGGTGCACCA
TGGGAAGGTAAATTGGGCAATATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCCAGGC
AAGCAAGCAAGTAGAACTTCTGGTCAAGTGGCATTAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGGAAATAAAACCTGCTAGG
AAGCCTGTAGTTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCTTGCA
GGATTAAATGGACAGTCCAACAGGAGACTTATATCAATGGATGAAGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCTTAAA
GGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGGGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCACGGCA
TTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGACAGCAAATAA
Edits in Original Sequence 
(5')XTTGGTGGTACTCCTCTTTATGCACAATGTACCACTCTAAATGCAGAGGAATCAGAAGAAATTCAAGAATGTATCGTAGCXGTAGG
TAGTCCGCCCATCAGCTTTGAACGAACATTGCGAATTAGAGGGAAAAACAACCCCTCAAGATCAGATTTCTCGGCGAXGGACCTTTTTGT
TCGTGTCATTGCTXCAGTTGAGCTAGTAATGGCTAATGATGATGATTTCACTTTTTGTCAGGTTGGAGCACCTGATAATCAAGATTATGT
GGATACACAGAAGATTGCTCATGATATTAGTGAAATTAGAATAAAAGATGAGCCCTCAAATAATGATGGTACTAGTCAAAGTAATGGTGC
ACCATGGGAAGGTAAATTGGGCAATATTACTACCTCAAAGAAGCAGGGAACAGTTGGTTCTTTGTCTTTCACTGTTATAGACACATCTCC
AGGCAAGCAAGCAAGTAGAACTTCTGGTCAAGTGGCATTAAAAGATGGTGGATTTTCAGTCCCAACTTATCAGAAGGAAATAAAACCTGC
TAGGAAGCCTGTAGTTCGAGCCAAGGTCCCCTATGAGAAGGGTTATAGTCAGATGGACTGGCTAAAGCTTACAAGAACACATCCTGACCT
TGCAGGATTAAATGGACAGTCCAACAGGAGACTTATATCAATGGATGAAGTTAAGGAACACCAAAATGCAGAAGCAATGTGGACTGTTCT
TAAAGGGCATGTCTACAATATAACACCATACATGAAGTTTCACCCAGGAGGGGTAGACATGCTGATGAAGGCCGTAGGAAAAGATTGCAC
GGCATTGTTTAACAAATACCATGCTTGGGTTAATGCTGAAGTTCTAATGGAGAAATGTCTTGTGGGCATTTTGGATGACAGCAAATAA(3')
AAGCTCCTTGTTTCATTGATCCCAGAAACAACTGTATCAAGAAAAACATTCTCACTACAAGAAGATTGTCCTTAACAGAAAACAAGAT
ATTTTGCTTCTTCTGAGGAAAAGCTTACATGCTATAGTATATTGGAGTAACTATTTACATACTCAAGGATTTTGAATTTTTTTAAAGCTG
TATGTCAAAGAAACTGTCTGAATCTTAGACTAATAAAACTTCAAGAAGCAGAAGCATCCTCTGTTATATTCATTAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan