ESTScan Details for Unigene SGN-U319118

Score 
490
Direction 
Forward
Predicted Peptide Sequence 
MSQQEPSKRYKRAKKNLALRGSLSFWANKKQRLLTTNEIFQAXRVRKRHFLNLIEEQHQGVAPKSQANENLKKXRQSLEEQPPDEQPLEE
QVEINSIIPPTNEQSXINTKNRKKQMNPHTAGKKSFALVRNKLEKEKETVSAKEIFXVHKNKETWAFVQDLDENTTSKIPLWVMNIXVRL
ILYGVGVTKTALKIKPGNFDHSLKATDDVVQQMQNNGETDGGTNKTMRQQAITKVIAQLQNAGLIDRNILAALFVPPPRENSTSSQAAYQ
GDLIEGDESSTEDLT
Predicted Coding Sequence 
ATGAGTCAACAAGAGCCTTCGAAAAGATACAAAAGAGCAAAAAAGAACCTTGCTTTACGTGGATCATTATCATTCTGGGCAAATAAAAAA
CAACGATTATTGACAACAAATGAAATATTTCAAGCTXATAGAGTGAGGAAACGACATTTTCTAAACTTAATTGAAGAACAACATCAAGGC
GTAGCACCAAAATCTCAAGCAAATGAAAATCTGAAGAAATTXAGGCAATCTTTAGAGGAACAACCTCCAGATGAGCAGCCCCTAGAAGAG
CAAGTGGAAATTAATTCTATCATTCCTCCAACAAATGAACAATCTGAXATAAATACTAAGAATCGAAAAAAGCAGATGAACCCACACACC
GCTGGCAAAAAGAGTTTTGCTTTAGTCCGTAACAAATTGGAAAAAGAAAAGGAAACTGTATCAGCTAAAGAGATCTTTGXTGTTCACAAG
AACAAGGAAACTTGGGCATTTGTACAAGACCTCGACGAAAACACAACTAGTAAAATTCCGTTATGGGTCATGAACATCCXGGTACGTCTC
ATACTGTATGGAGTGGGGGTTACAAAGACTGCATTGAAAATAAAACCTGGAAATTTTGACCATTCTTTAAAGGCCACAGATGATGTAGTT
CAACAAATGCAAAATAACGGAGAAACGGATGGAGGAACAAATAAAACTATGCGACAACAAGCTATCACAAAAGTAATTGCACAACTTCAA
AATGCAGGATTAATTGATCGGAACATACTAGCTGCATTATTTGTTCCTCCTCCAAGAGAAAATAGTACTTCCTCACAAGCGGCTTATCAA
GGAGATTTAATTGAAGGAGATGAAAGCAGTACTGAAGACTTGACTTAG
Edits in Original Sequence 
TTTCATTTAGGGTTACAACTTTGGACTTCTTCTTGCAAAAGGACTTCCGAAAAATGGAAAGGATAATGTGAGCTCCGGTTAATCGCAGTA
TATTTCTTCAACAAGATCCGGTCTTCTTCTTCTTCATAGTGAGGCAGTCTTCTTCTTCTGTTTGACAAGTATTTTTCTTCATCTCCATTG
GTCTTAGTCTCCAACAGTAATCTTCTTCTACCGCAATTTTTTATAAAGTTTTTTCTCAGATTGGAGACTCTTTTTCCTTCCAAAGCTCAT
CAAAACTAGCTCGTGGTCGTTGAAGCTTGTGGCCAGCTCGTGCTCGTCCCAGTATGGCTGCTCCAAAGAAGGTTTGGGGCTTATTCTAAG
TAGAATTTAAAGTTTATTCTCTTGTCAATTAAATTTGTTGGCCTGGCTACATGTTTCCAGCAGGATTTGAATAGTC
(5')ATGAGTCAAC
AAGAGCCTTCGAAAAGATACAAAAGAGCAAAAAAGAACCTTGCTTTACGTGGATCATTATCATTCTGGGCAAATAAAAAACAACGATTAT
TGACAACAAATGAAATATTTCAAGCTXATAGAGTGAGGAAACGACATTTTCTAAACTTAATTGAAGAACAACATCAAGGCGTAGCACCAA
AATCTCAAGCAAATGAAtAATCTGAAGAAATTXAGGCAATCTTTAGAGGAACAACCTCCAGATGAGCAGCCCCTAGAAGAGCAAGTGGAA
ATTAATTCTATCATTCCTCCAACAAATGAACAATCTGAXATAAATACTAAGAATCGAAAAAAGCAGATGAACCCACACACCGCTGGCAAA
AAGAGTTTTGCTTTAGTCCGTAACAAATTGGAAAAAGAAAAGGAAACTGTATCAGCTAAAGAGATCTTTGXTGTTCACAAGAACAAGGAA
ACTTGGGCATTTGTACAAGACCTCGACGAAAACACAACTAGTAAAATTCCGTTATGGGTCATGAACATCCXGGTACGTCTCATACTGTAT
GGAGTGGGGGTTACAAAGACTGCATTGAAAATAAAACCTGGAAATTTTGACCATTCTTTAAAGGCCACAGATGATGTAGTTCAACAAATG
CAAAATAACGGAGAAACGGATGGAGGAACaAAATAAAACTATGCGACAACAAGCTATCACAAAAGTAATTGCACAACTTCAAAATGCAGG
ATTAATTGATCGGAACATACTAGCTGCATTATTTGTTCCTCCTCCAAGAGAAAATAGTACTTCCTCACAAGCGGCTTATCAAGGAGATTT
AATTGAAGGAGATGAAAGCAGTACTGAAGACTTGACTTAG(3')GAGTTAACTGGATTGATGTTAATTAACTTTAATCATTTATGTTTTA
CAAATATTTTGATTTTGATTAATATTGAAAATTGTGGTGTGTTTCATCCTTTTTGAACATTCAAAAAAAATTGTATATTTTGTTATTATG
AAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan