ESTScan Details for Unigene SGN-U319220

Score 
632
Direction 
Forward
Predicted Peptide Sequence 
MGQQQSKGELLYQQVNYGNVEGIKSLHREGAGLEWIDKEGKTPLIVACMNPGLYNVAKTLIELGANVDAYRPGRHAGTPLHHAAKRGLEQ
TVKLLLSHRANALLMNDDCQTPLDVARIKGFSNVVRAIESHICLFSGWLRELYGPGFLELLAPQLLXSESLGGRLTMWFPKSQKAFQVGA
AIYSAVQDAQPRTIVALWKANMEEPNFSQPDSAVIISDISNRARIKLTAVQESEKQQLQSFCNACKGIPQVMHPAFPFSSQPPMVPATAP
STTEDVELAMAITASLQSASQQRPTYHENHTGSGAETSMGX
Predicted Coding Sequence 
ATGGGGCAGCAGCAATCCAAAGGCGAGCTTCTGTATCAGCAAGTTAATTATGGAAATGTTGAAGGTATCAAATCTCTCCACCGTGAAGGC
GCTGGACTTGAGTGGATAGATAAGGAAGGGAAGACACCATTGATTGTGGCGTGCATGAATCCGGGGCTTTACAATGTTGCAAAAACTTTG
ATAGAATTGGGTGCCAATGTCGATGCTTATCGTCCAGGTCGTCATGCGGGGACTCCTCTACATCATGCAGCAAAAAGAGGCCTTGAACAG
ACGGTTAAGTTACTCCTTTCACATAGAGCTAATGCATTGCTAATGAATGATGACTGCCAAACTCCCCTTGATGTTGCCAGAATTAAAGGT
TTCAGCAATGTTGTCCGTGCAATTGAGAGCCATATTTGCTTATTTTCTGGTTGGCTACGGGAACTTTATGGGCCTGGATTCCTTGAACTA
TTGGCACCACAGTTGCTTAXGTCGGAAAGTTTGGGTGGTCGTCTTACCATGTGGTTCCCGAAATCTCAGAAAGCCTTTCAGGTTGGAGCT
GCTATATATTCAGCTGTCCAGGATGCTCAGCCCCGCACAATAGTTGCTCTGTGGAAGGCCAATATGGAAGAACCAAATTTCAGCCAACCT
GATTCAGCAGTTATCATATCCGATATTTCAAACAGAGCAAGGATCAAACTTACAGCAGTCCAGGAAAGCGAAAAGCAGCAATTGCAATCT
TTCTGCAATGCATGCAAGGGAATACCTCAGGTCATGCATCCAGCATTTCCTTTCAGTTCTCAACCCCCTATGGTCCCTGCAACTGCTCCA
TCAACCACAGAGGATGTGGAATTAGCAATGGCGATCACTGCCTCTCTTCAGTCTGCTTCACAACAAAGACCAACCTATCACGAGAATCAC
ACGGGATCAGGAGCAGAAACATCAATGGGTTXX
Edits in Original Sequence 
CGAAAATCATACCTCTTTCTTCAATAATTTTTCCCCAAAAATAAATACAGAGGAAAATTTTTGCTAATTTTTCTTCAATTTTATCTTCTA
CA
(5')ATGGGGCAGCAGCAATCCAAAGGCGAGCTTCTGTATCAGCAAGTTAATTATGGAAATGTTGAAGGTATCAAATCTCTCCACCGT
GAAGGCGCTGGACTTGAGTGGATAGATAAGGAAGGGAAGACACCATTGATTGTGGCGTGCATGAATCCGGGGCTTTACAATGTTGCAAAA
ACTTTGATAGAATTGGGTGCCAATGTCGATGCTTATCGTCCAGGTCGTCATGCGGGGACTCCTCTACATCATGCAGCAAAAAGAGGCCTT
GAACAGACGGTTAAGTTACTCCTTTCACATAGAGCTAATGCATTGCTAATGAATGATGACTGCCAAACTCCCCTTGATGTTGCCAGAATT
AAAGGTTTCAGCAATGTTGTCCGTGCAATTGAGAGCCATATTTGCTTATTTTCTGGTTGGCTACGGGAACTTTATGGGCCTGGATTCCTT
GAACTATTGGCACCACAGTTGCTTAXGTCGGAAAGTTTGGGTGGTCGTCTTACCATGTGGTTCCCGAAATCTCAGAAAGCCTTTCAGGTT
GGAGCtTGCTATATATTCAGCTGTCCAGGATGCTCAGCCCCGCACAATAGTTGCTCTGTGGAAGGCCAATATGGAAGAACCAAATTTCAG
CCAACCTGATTCAGCAGTTATCATATCCGATATTTCAAACAGAGCAAGGATCAAACTTACAGCAGTCCAGGAAAGCGAAAAGCAGCAATT
GCAATCTTTCTGCAATGCATGCAAGGGAATACCTCAGGTCATGCATCCAGCATTTCCTTTCAGTTCTCAACCCCCTATGGTCCCTGCAAC
TGCTCCATCAACCACAGAGGATGTGGAATTAGCAATGGCGATCACTGCCTCTCTTCAGTCTGCTTCACAACAAAGACCAACCTATCACGA
GAATCACACGGGATCAGGAGCAGAAACATCAATGGGTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan