ESTScan Details for Unigene SGN-U319272

Score 
1499
Direction 
Forward
Predicted Peptide Sequence 
MALTAATAGGNRGGSALPNSCLQAPKPAPLQKPIFFSSFPKITIPQTPKSNQESNPSQPFNLHPQQQQKLLKTQKENGVSKAGNXKPASQ
LPEYPDKVKLESVLETLSTYPPIVFAGEARNLEEKLGEAALGNAFLLQGGDCAESFKEFSANNIRDTFRVILQMGVVLMFGGQMPVIKVG
RMAGQFAKPRSDPFEEKDGVKLPSYRGDNVNGDTFDEISRIPDPHRMIRAYTQSVATLNLLRAFATGGYAAMQRVNEWNLDFTDRSEQGD
RYRELAHRVDETMGFMTAAGLTVDHPIMTTTDFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMIWVGERTRQLDGAHVEFLRGIANPL
GIKVSHKMDPNELVKLIDILNPQNRPGRITVIARMGADNMRVKLPHLIRAIRGAGQIVTWVSDPMHGNTTKAPCGLKTRSFDSIRAEVRA
FFDVHDQEGSYPGGVHLEMTGQNVTECVGGSRTITYNDLSSRYHTHCDPRLNASQALELAFIIAERLRKRRLGPKFGF
Predicted Coding Sequence 
ATGGCTCTGACAGCAGCCACCGCCGGCGGCAACAGGGGTGGCTCAGCCCTCCCCAATTCGTGCCTTCAAGCCCCAAAACCTGCACCGTTG
CAGAAACCCATCTTCTTCTCTTCCTTTCCCAAAATAACAATCCCTCAAACTCCAAAATCAAACCAAGAATCAAACCCATCTCAGCCGTTC
AATCTCCACCCTCAACAACAGCAAAAACTGCTCAAAACCCAGAAGGAAAATGGAGTCTCGAAAGCTGGAAATCXGAAGCCGGCTTCTCAG
CTCCCTGAATACCCTGATAAGGTAAAGCTGGAATCAGTTCTCGAGACCCTTTCGACGTATCCCCCAATTGTATTTGCTGGGGAAGCTCGG
AATCTTGAAGAGAAATTGGGCGAAGCTGCTCTTGGGAATGCTTTCTTGTTGCAGGGTGGTGATTGTGCTGAGAGCTTTAAGGAATTTAGT
GCTAATAACATTAGGGACACTTTCAGAGTCATCTTGCAGATGGGCGTTGTGCTTATGTTTGGTGGTCAAATGCCTGTAATCAAGGTGGGT
AGAATGGCAGGTCAATTTGCAAAGCCAAGATCTGATCCATTTGAAGAGAAGGATGGCGTGAAGCTGCCAAGTTACAGGGGAGACAATGTG
AATGGCGATACTTTTGATGAGATATCAAGAATTCCTGACCCCCATAGGATGATTAGGGCCTATACTCAGTCTGTAGCTACATTGAACCTC
CTCAGGGCATTTGCTACTGGAGGTTATGCTGCCATGCAGAGGGTTAACGAGTGGAATCTTGACTTTACTGATCGCAGCGAGCAAGGTGAC
AGGTACCGTGAACTGGCTCACCGAGTTGACGAAACCATGGGCTTCATGACTGCTGCTGGGCTTACAGTTGACCACCCAATCATGACTACA
ACAGACTTCTGGACATCACATGAGTGCCTTCTCTTGCCTTATGAACAAGCACTTACTAGAGAGGATTCAACTTCTGGCCTTTATTATGAC
TGCTCCGCTCATATGATTTGGGTTGGGGAACGAACAAGGCAATTGGATGGTGCTCATGTTGAGTTTCTGAGAGGAATTGCCAATCCACTT
GGAATCAAGGTGAGTCATAAAATGGATCCAAATGAACTAGTCAAGCTTATTGACATTCTTAACCCTCAAAATAGACCAGGAAGGATTACA
GTAATCGCCAGGATGGGAGCTGATAACATGAGAGTAAAGCTTCCCCATCTGATCAGGGCTATTCGTGGAGCTGGTCAAATTGTCACTTGG
GTCAGTGATCCTATGCATGGAAATACTACTAAAGCCCCTTGTGGACTCAAAACACGTTCATTCGACTCTATTCGGGCTGAGGTTCGAGCA
TTCTTTGATGTACACGATCAAGAAGGTAGCTATCCTGGTGGTGTGCATCTGGAGATGACAGGTCAGAATGTAACAGAGTGTGTTGGAGGT
TCTCGGACAATTACTTACAATGATCTGAGCTCGCGCTATCATACACATTGTGACCCAAGACTCAATGCTTCTCAAGCACTTGAACTTGCC
TTTATTATTGCGGAGCGCCTCAGGAAAAGAAGACTGGGTCCTAAGTTTGGGTTTTAG
Edits in Original Sequence 
GAGATAATTGAATTCTCTTTGTATTCCCTAATCCCAACCCAAAA(5')ATGGCTCTGACAGCAGCCACCGCCGGCGGCAACAGGGGTGGC
TCAGCCCTCCCCAATTCGTGCCTTCAAGCCCCAAAACCTGCACCGTTGCAGAAACCCATCTTCTTCTCTTCCTTTCCCAAAATAACAATC
CCgTCAAACTCCAAAATCAAACCAAGAATCAAACCCATCTCAGCCGTTCAATCTCCACCCTCAACAACAGCAAAAACTGCTCAAAACCCA
GAAGGAAAATGGAGTCTCGAAAGCTGGAAATCXGAAGCCGGCTTCTCAGCTCCCTGAATACCCTGATAAGGTAAAGCTGGAATCAGTTCT
CGAGACCCTTTCGACGTATCCCCCAATTGTATTTGCTGGGGAAGCTCGGAATCTTGAAGAGAAATTGGGCGAAGCTGCTCTTGGGAATGC
TTTCTTGTTGCAGGGTGGTGATTGTGCTGAGAGCTTTAAGGAATTTAGTGCTAATAACATTAGGGACACTTTCAGAGTCATCTTGCAGAT
GGGCGTTGTGCTTATGTTTGGTGGTCAAATGCCTGTAATCAAGGTGGGTAGAATGGCAGGTCAATTTGCAAAGCCAAGATCTGATCCATT
TGAAGAGAAGGATGGCGTGAAGCTGCCAAGTTACAGGGGAGACAATGTGAATGGCGATACTTTTGATGAGATATCAAGAATTCCTGACCC
CCATAGGATGATTAGGGCCTATACTCAGTCTGTAGCTACATTGAACCTCCTCAGGGCATTTGCTACTGGAGGTTATGCTGCCATGCAGAG
GGTTAACGAGTGGAATCTTGACTTTACTGATCGCAGCGAGCAAGGTGACAGGTACCGTGAACTGGCTCACCGAGTTGACGAAACCATGGG
CTTCATGACTGCTGCTGGGCTTACAGTTGACCACCCAATCATGACTACAACAGACTTCTGGACATCACATGAGTGCCTTCTCTTGCCTTA
TGAACAAGCACTTACTAGAGAGGATTCAACTTCTGGCCTTTATTATGACTGCTCCGCTCATATGATTTGGGTTGGGGAACGAACAAGGCA
ATTGGATGGTGCTCATGTTGAGTTTCTGAGAGGAATTGCCAATCCACTTGGAATCAAGGTGAGTCATAAAATGGATCCAAATGAACTAGT
CAAGCTTATTGACATTCTTAACCCTCAAAATAGACCAGGAAGGATTACAGTAATCGCCAGGATGGGAGCTGATAACATGAGAGTAAAGCT
TCCCCATCTGATCAGGGCTATTCGTGGAGCTGGTCAAATTGTCACTTGGGTCAGTGATCCTATGCATGGAAATACTACTAAAGCCCCTTG
TGGACTCAAAACACGTTCATTCGACTCTATTCGGGCTGAGGTTCGAGCATTCTTTGATGTACACGATCAAGAAGGTAGCTATCCTGGTGG
TGTGCATCTGGAGATGACAGGTCAGAATGTAACAGAGTGTGTTGGAGGTTCTCGGACAATTACTTACAATGATCTGAGCTCGCGCTATCA
TACACATTGTGACCCAAGACTCAATGCTTCTCAAGCACTTGAACTTGCCTTTATTATTGCGGAGCGCCTCAGGAAAAGAAGACTGGGTCC
TAAGTTTGGGTTTTAG(3')AAAACCGATCTTACTCCCCTTTCACTAGTATTCGCAGTTTGGCCTCTGTGTGAAGAGGTATAAGCATAGT
ATGGGAAGATTCAATTTTATAGTAATATGACACTCAAAACATGGAAACTCAGAAAGGCTATTCTACAGTGTATGTGTTAAGATAGGACGG
ACCTCTTGATGCTTAAAGATTGTATATATATAATAAATAAGATCTTCGCAAGTAATGCGAACTGACTCTGTTTGGTTTGATATATGGAGT
AATATTTTTAGTGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan