ESTScan Details for Unigene SGN-U319349

Score 
573
Direction 
Forward
Predicted Peptide Sequence 
MTCFPLFHRKHQSSTRHASEFDDELSGVKNVTLFSYKQLRIATDDFSTLNKIGEGGFGSVYKGRLKSGKMAAIKVLSSESKQGVREFLTE
IKVISDVDHENLVKLYGCCIEDDHRILVYNYLENNSLAQTLLGGGHSSIQFSWRTRTKICIGVAKGLAYLHEQVKPHIIHRDIKASNILL
DKDLTPKISDFGLAKLIPPNATHVSTRVAGTIGYLAPEYAIRGQATRKSDVYSYGVLLIEIVTGRCNTNSRLPIDEQYLLERTWQLYERN
ELVMLVDTSLDGDFDAEQACRYLKIGLLCTQDALKLRPSMSTILKMLNGEMEVNDNKITKPGLISDFMDLKIKSSAPEQINAAYDYVLSD
NTTLPSTSSSQGNSTFTTAAYDQSI
Predicted Coding Sequence 
ATGACTTGCTTCCCTTTGTTCCATAGAAAACATCAGTCATCAACTAGGCATGCATCTGAATTTGATGATGAGCTCTCTGGCGTCAAGAAT
GTCACTCTTTTCTCCTATAAGCAGTTAAGAATCGCCACAGATGATTTTAGTACTTTAAATAAAATTGGAGAGGGTGGATTTGGTTCTGTT
TATAAGGGAAGGCTAAAAAGTGGAAAGATGGCTGCTATAAAGGTTCTTTCAAGTGAATCAAAGCAAGGTGTCAGGGAGTTCTTGACAGAA
ATCAAAGTAATTTCAGACGTTGACCATGAAAATCTAGTGAAACTCTATGGCTGTTGTATAGAAGACGATCACAGGATATTGGTCTACAAC
TATCTTGAAAACAACAGCCTTGCTCAAACGCTTCTCGGTGGAGGACACAGTAGCATCCAGTTCAGTTGGCGAACAAGGACTAAAATTTGC
ATTGGAGTTGCGAAGGGGCTAGCTTATCTTCATGAGCAAGTGAAGCCACATATAATTCACCGTGATATCAAAGCGAGTAATATTCTCCTT
GACAAAGACTTGACACCCAAGATTTCAGATTTTGGCCTGGCAAAGCTCATTCCCCCCAACGCTACTCATGTTAGTACACGTGTGGCAGGA
ACCATTGGCTATTTGGCACCAGAGTATGCAATTAGAGGTCAGGCAACACGTAAATCAGATGTTTACAGTTATGGTGTTCTTCTGATAGAA
ATTGTCACTGGAAGATGCAACACAAACTCGCGTTTACCTATTGACGAACAATATCTCCTTGAAAGGACGTGGCAACTTTATGAAAGAAAC
GAGTTGGTAATGCTAGTAGACACGTCTCTAGACGGGGATTTTGATGCTGAACAGGCCTGCAGATACTTGAAGATTGGGCTCCTATGCACT
CAAGACGCCTTAAAGCTGCGGCCATCCATGTCTACTATTCTCAAGATGCTAAACGGTGAGATGGAGGTCAATGACAATAAGATAACAAAA
CCAGGCTTGATCTCCGATTTCATGGATCTCAAGATTAAAAGTAGCGCGCCTGAACAAATTAATGCAGCATATGATTACGTCTTATCAGAC
AATACAACGTTACCATCCACGAGTTCTTCTCAAGGTAACTCGACATTCACTACCGCTGCATATGATCAAAGCATTTGA
Edits in Original Sequence 
GGACAGACAAAGTCTTCTTCTTCTTCATGTATGTACTATTTTTTGGGGCGTGTCTGCAATTATTAGTGTGAACAAGAAATTTTCCCTCTA
AAAGACTTCCATAAGACTCTTAAGATTCTTGGGATCTATCCCATTTCACTTCTTTGGAAAACTCAAAAAAAAAAGGAACCCAAAAAACAG
CAAGGTCACCTGCTTTTGTTTTCTGCTATTTTTTGAGGCTCTGATTTTGGTTGATATCATATACAGAAGGTCATTGGTGCATCCTAAAGT
T
(5')ATGACTTGCTTCCCTTTGTTCCATAGAAAACATCAGTCATCAACTAGGCATGCATCTGAATTTGATGATGAGCTCTCTGGCGTCA
AGAATGTCACTCTTTTCTCCTATAAGCAGTTAAGAATCGCCACAGATGATTTTAGTACTTTAAATAAAATTGGAGAGGGTGGATTTGGTT
CTGTTTATAAGGGAAGGCTAAAAAGTGGAAAGATGGCTGCTATAAAGGTTCTTTCAAGTGAATCAAAGCAAGGTGTCAGGGAGTTCTTGA
CAGAAATCAAAGTAATTTCAGACGTTGACCATGAAAATCTAGTGAAACTCTATGGCTGTTGTATAGAAGACGATCACAGGATATTGGTCT
ACAACTATCTTGAAAACAACAGCCTTGCTCAAACGCTTCTCGGTGGAGGACACAGTAGCATCCAGTTCAGTTGGCGAACAAGGACTAAAA
TTTGCATTGGAGTTGCGAAGGGGCTAGCTTATCTTCATGAGCAAGTGAAGCCACATATAATTCACCGTGATATCAAAGCGAGTAATATTC
TCCTTGACAAAGACTTGACACCCAAGATTTCAGATTTTGGCCTGGCAAAGCTCATTCCCCCCAACGCTACTCATGTTAGTACACGTGTGG
CAGGAACCATTGGCTATTTGGCACCAGAGTATGCAATTAGAGGTCAGGCAACACGTAAATCAGATGTTTACAGTTATGGTGTTCTTCTGA
TAGAAATTGTCACTGGAAGATGCAACACAAACTCGCGTTTACCTATTGACGAACAATATCTCCTTGAAAGGACGTGGCAACTTTATGAAA
GAAACGAGTTGGTAATGCTAGTAGACACGTCTCTAGACGGGGATTTTGATGCTGAACAGGCCTGCAGATACTTGAAGATTGGGCTCCTAT
GCACTCAAGACGCCTTAAAGCTGCGGCCATCCATGTCTACTATTCTCAAGATGCTAAACGGTGAGATGGAGGTCAATGACAATAAGATAA
CAAAACCAGGCTTGATCTCCGATTTCATGGATCTCAAGATTAAAAGTAGCGCGCCTGAACAAATTAATGCAGCATATGATTACGTCTTAT
CAGACAATACAACGTTACCATCCACGAGTTCTTCTCAAGGTAACTCGACATTCACTACCGCTGCATATGATCAAAGCATTTGA(3')GCT
TAGATTTTTGGAGTTAATTGGAAAATTTTGGTGTGGTGGAGGGAGGTAAAATAGTTTGTATTTGGTTGAATATTACTTTCAACTTTGTTT
TATTCTATTTCTTTTTCCTCTATACTTGTTTTTTTTTTTTAAAATCTTTGGTTGATCTGTATATGTAAATTATTCACATGTTGTTAGAAA
GAGTGTATATTGTAAATTTGAGGTGTTGAATTCAAGAGAATGTAATTTTCTCTAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan