ESTScan Details for Unigene SGN-U319376

Score 
1053
Direction 
Forward
Predicted Peptide Sequence 
MEHHTTTSRAEAERLLGVAEKLLRDKEFAPCKDFALLAQETEPLLEGPDQILAIAEVLLASVKRINNHHDWYSILQIQGRTEDSELIKKQ
YRRLALLLHPDKNKYPSSDTAFGLVADAWAVLSDPSKKGLYDNELSLFGRVKLTPSARRGRPRGSYNKQKKGDAKLPVRRSSRASNSGSG
QNQNPNPSPVSQKSYHSAPPKATAPAPMSGAMRGQRVVNLWTACPYCYNLYEYPRVYEGVVYDVINVKXAFTATEILSMPPMVPGKEAYY
CIWGFFPMGFVNGNLEDLGTVKGAAAAAATTGAFPTWMPPMFSTQNAANNQQNATPIPATVQVTNPAPAAASAPPPAPPPAAAAPRPMST
GPKKRGRPRKYN
Predicted Coding Sequence 
ATGGAGCATCATACAACTACAAGCAGAGCAGAAGCAGAGAGACTGTTAGGAGTTGCAGAAAAGCTGTTAAGAGATAAAGAATTTGCCCCT
TGTAAAGATTTTGCACTTCTTGCTCAAGAAACCGAGCCTTTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCT
TCTGTTAAACGAATCAACAATCACCATGATTGGTACTCTATTCTTCAAATCCAAGGTCGTACTGAAGATTCAGAGCTTATCAAGAAACAG
TATCGTCGTCTTGCTCTTCTTCTTCATCCTGATAAAAACAAATACCCATCTTCAGATACTGCTTTCGGCCTTGTTGCTGATGCTTGGGCT
GTTCTTTCAGATCCATCAAAAAAGGGTCTTTATGATAATGAACTTTCCCTTTTTGGTAGAGTTAAATTGACTCCTTCTGCTCGACGAGGA
AGACCTAGAGGGAGTTATAATAAGCAGAAGAAAGGAGATGCGAAGTTACCTGTGAGGAGGAGTAGTCGAGCGAGTAATTCGGGTTCGGGT
CAAAATCAGAACCCTAATCCCAGTCCGGTGAGTCAGAAGAGTTATCATAGTGCGCCGCCGAAGGCTACGGCGCCGGCGCCGATGAGTGGT
GCGATGAGAGGGCAAAGGGTGGTGAATTTGTGGACGGCGTGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAGGTGTT
GTTTACGATGTGATAAATGTAAAAGXGGCTTTTACTGCTACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAAAGAAGCTTATTAT
TGCATTTGGGGTTTTTTTCCAATGGGTTTTGTGAATGGGAATTTGGAGGATTTGGGTACTGTGAAAGGAGCTGCTGCTGCTGCTGCAACT
ACTGGTGCATTTCCAACTTGGATGCCACCGATGTTTTCGACTCAAAATGCTGCGAATAATCAACAAAATGCTACTCCAATTCCAGCTACG
GTTCAGGTAACGAATCCAGCGCCAGCXGCGGCCTCAGCTCCTCCTCCTGCTCCTCCTCCTGCTGCTGCTGCTCCCAGACCAATGTCGACA
GGACCTAAGAAAAGAGGTAGGCCTAGGAAGTATAACTAA
Edits in Original Sequence 
AATCTTTTTACACTCGATAGTTACACCCCACTACCCCCCACCCCACCCCCTCTTCCTCTTCCCCAAATCAACCATCAATTTCTCCGTCTC
CATTTCAGATCAAACCCCCAAAGCCCTAAAATCCCCAAAAATTGAGGAAAAA
(5')ATGGAGCATCATACAACTACAAGCAGAGCAGAAG
CAGAGAGACTGTTAGGAGTTGCAGAAAAGCTGTTAAGAGATAAAGAATTTGCCCCTTGTAAAGATTTTGCACTTCTTGCTCAAGAAACCG
AGCCTTTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCTTCTGTTAAACGAATCAACAATCACCATGATTGGT
ACTCTATTCTTCAAATCCAAGGTCGTACTGAAGATTCAGAGCTTATCAAGAAACAGTATCGTCGTCTTGCTCTTCTTCTTCATCCTGATA
AAAACAAATACCCATCTTCAGATACTGCTTTCGGCCTTGTTGCTGATGCTTGGGCTGTTCTTTCAGATCCATCAAAAAAGGGTCTTTATG
ATAATGAACTTTCCCTTTTTGGTAGAGTTAAATTGACTCCTTCTGCTCGACGAGGAAGACCTAGAGGGAGTTATAATAAGCAGAAGAAAG
GAGATGCGAAGTTACCTGTGAGGAGGAGTAGTCGAGCGAGTAATTCGGGTTCGGGTCAAAATCAGAACCCTAATCCCAGTCCGGTGAGTC
AGAAGAGTTATCATAGTGCGCCGCCGAAGGCTACGGCGCCGGCGCCGATGAGTGGTGCGATGAGAGGGCAAAGGGTGGTGAATTTGTGGA
CGGCGTGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAgGGTGTTGTTTACGATGTGATAAATGTAAAAGXGGCTTTT
ACTGCTACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAAAGAAGCTTATTATTGCATTTGGGGTTTTTTTCCAATGGGTTTTGTG
AATGGGAATTTGGAGGATTTGGGTACTGTGAAAGGAGCTGCTGCTGCTGCTGCAACTACTGGTGCATTTCCAACTTGGATGCCACCGATG
TTTTCGACTCAAAATGCTGCGAATAATCAACAAAATGCTACTCCAATTCCAGCTACGGTTCAGGTAACGAATCCAGCGCCAGCXGCGGCC
TCAgGCTCCTCCTCCTGCTCCTCCTCCTGCTGCTGCTGCTCCCAGACCAATGTCGACAGGACCTAAGAAAAGAGGTAGGCCTAGGAAGTA
TAACTAA(3')AAAAGGTTTGATTTTTATGGTTTGTCTCAAGAATTTTGAGTCTTATGGAGATTATAATGTTTAGTTTGATCAAGTCGAC
TGGAATTGAATGATCGATCGAATCTTGTAGTAAGTTGAGTAGTGAGCAAAAGTAGTTGCTTTTCTTTACTCATCATATGAAGAAGTATAT
AACTGCAGAACTGTGCTGTAGCTTGTTCTTGTTAGATGCCTTGTGTTTGTAGAAATTTCTCGTTGTTGGTAGATTTTCTGCGGTTTGTAG
GTACTATATTTATTCAATTTTCAAGACTCGTAGTCATAGACTCGTTTTGTAATTGAATGATCTTTATGCCAAATTTCGAAATTCTAATTT
CTGTCTCGTTCAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAATAAAAAAAAGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan