ESTScan Details for Unigene SGN-U319379

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
SSSLLVKNHYTQGLRERHVNGGTYGNAVQMVYGVPLMTGGYHTGFGQLGVVAAGGGQYMDQPVYNFVPAVTSVMVPDQHKMIVSTTDTLS
REIKS
Predicted Coding Sequence 
AGCAGCAGCTTGTTGGTGAAGAATCATTACACACAAGGGTTACGTGAAAGGCACGTGAATGGTGGGACCTATGGTAATGCGGTGCAAATG
GTTTACGGGGTACCACTGATGACTGGTGGGTATCACACTGGGTTTGGGCAGTTGGGAGTAGTGGCTGCAGGTGGTGGCCAATACATGGAC
CAGCCTGTCTACAATTTTGTGCCTGCAGTGACTTCGGTGATGGTCCCAGATCAGCACAAGATGATTGTGTCTACAACTGATACTCTCAGC
CGTGAAATCAAAAGTTGA
Edits in Original Sequence 
(5')AGCAGCAGCTTGTTGGTGAAGAATCATTACACACAAGGGTTACGTGAAAGGCACGTGAATGGTGGGACCTATGGTAATGCGGTGCA
AATGGTTTACGGGGTACCACTGATGACTGGTGGGTATCACACTGGGTTTGGGCAGTTGGGAGTAGTGGCTGCAGGTGGTGGCCAATACAT
GGACCAGCCTGTCTACAATTTTGTGCCTGCAGTGACTTCGGTGATGGTCCCAGATCAGCACAAGATGATTGTGTCTACAACTGATACTCT
CAGCCGTGAAATCAAAAGTTGA(3')TCAGAACGTATCGTAACAGAGGTCATCATATCATCTTCATCCTTTTTCTCTTTCTTTCCAACAT
TGGTGAATTCTAAAATGGTACATAGAGTAAATAGCCACTGGTTTCTTTTTCCATTCTCATTTACTAAGGTGTTTACTCTTTGATATGTGT
AATGAGTTTTTACCCCTTTTATGCAGCATATGTTTCCCATTATCTCAGATATTCTGTATATCATCATCATCATCATTAGTTAGAGATTAC
AATTTTTCCCATTAAAAAAAAGCTTCAAGTTGTTTTCTTCTTTCTTTCTTTTTGATACTTTATGGTGGTCCTATCTGTGGCGACAGCTAC
CATCTTCCATATCATTAATGGAGGCCACTGCAAGCTCTATAACTTTTTTTCTTGTTCCTGCTTTTCCCTTTAATTAGTAAAAGTTTGTTT
ATTCTTGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan