ESTScan Details for Unigene SGN-U319478

Score 
615
Direction 
Forward
Predicted Peptide Sequence 
MAGRGKTLGSGTAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVR
NDEELSKLLGDVTIANGGVMPNIHNLLLPKKTGGSKPSADED
Predicted Coding Sequence 
ATGGCTGGTAGAGGCAAAACCCTAGGTTCAGGAACAGCAAAAAAGGCTACTTCTCGTAGTAGCAAAGCTGGTCTTCAGTTTCCGGTTGGT
CGTATTGCTCGGTTTTTGAAAGCCGGGAAGTATGCTGAACGTGTCGGTGCCGGAGCTCCGGTTTATCTAGCTGCTGTTCTGGAGTACCTT
GCTGCTGAGGTTCTTGAGTTAGCTGGAAATGCAGCAAGGGACAACAAGAAGACTAGGATCGTTCCGAGGCATATTCAATTGGCAGTGAGG
AACGATGAGGAACTAAGCAAACTTCTCGGAGATGTAACGATTGCCAATGGCGGTGTGATGCCCAACATTCACAACCTTCTGCTTCCAAAG
AAAACCGGTGGTTCAAAGCCATCTGCTGATGAAGATTAA
Edits in Original Sequence 
TTTTTGCTCTCAAAATTTGAACCTACAAAAATTTTCTCCATTTTTATAGCAAATTTCTTCCATAA(5')ATGGCTGGTAGAGGCAAAACC
CTAGGTTCAGGAACAGCAAAAAAGGCTACTTCTCGTAGTAGCAAAGCTGGTCTTCAGTTTCCGGTTGGTCGTATTGCTCGGTTTTTGAAA
GCCGGGAAGTATGCTGAACGTGTCGGTGCCGGAGCTCCGGTTTATCTAGCTGCTGTTCTGGAGTACCTTGCTGCTGAGGTTCTTGAGTTA
GCTGGAAATGCAGCAAGGGACAACAAGAAGACTAGGATCGTTCCGAGGCATATTCAATTGGCAGTGAGGAACGATGAGGAACTAAGCAAA
CTTCTCGGAGATGTAACGATTGCCAATGGCGGTGTGATGCCCAACATTCACAACCTTCTGCTTCCAAAGAAAACCGGTGGTTCAAAGCCA
TCTGCTGATGAAGATTAA(3')ACATATTCAAGACTTGGTTTTTCTTAGTTTATAGCTCTTTGTTCTTTTTCTGGAATAGTATTAAGGAT
TTGCTAGTGTTTCTTTAGGTGTTTAGTAGATTTTGGGGTTTATGTTTTGTTTTTGTGTATACACAAATGATTTGAGCAATGAATGAAAAC
ATCAATGTGTTCAAGAAAAAAAAATAAAAATTGACGAAATGTGAGTGTATGCATCAAATCGAATGAGTCGATGTAATTGAGCTTAGTTTG
ATTGTGTATCTTGACATGGTTAATGGTTCTTGTGTTGATGGAAATCTTTCTTTATTGCGATTTTTATCATCCATCGAGTTTTGAAATGTG
CGCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan