ESTScan Details for Unigene SGN-U319482

Score 
235
Direction 
Forward
Predicted Peptide Sequence 
MASKTIASQSSVPLFLSLNLLLFAVVSGTNDTGNCVGSQQTCSIDTLKLGVCANILNLVNVIVGSPPTXAMLQFDPGTDGPRGRGLLGTA
IKANVLGINLNVPLSLSLILNTCGKKYPTGFTC
Predicted Coding Sequence 
ATGGCTTCCAAAACAATTGCAAGTCAGTCTTCAGTACCCCTTTTCCTATCACTGAATCTCCTGTTGTTTGCTGTTGTAAGTGGAACCAAT
GATACTGGAAATTGCGTTGGTTCTCAACAAACATGCTCAATAGATACTTTGAAACTTGGTGTGTGTGCTAATATACTTAATTTGGTGAAT
GTAATAGTCGGGTCTCCACCAACTXTTGCCATGCTGCAGTTTGATCCAGGGACTGACGGACCTAGAGGCCGCGGTTTGCTTGGCACAGCC
ATAAAAGCAAATGTGCTGGGAATTAATTTGAATGTACCACTCTCTCTGAGCCTCATACTAAACACATGTGGAAAGAAATATCCTACTGGC
TTCACTTGTTAA
Edits in Original Sequence 
ATTAATATTCTCTAGATTTGAAT(5')ATGGCTTCCAAAACAATTGCAAGTCAGTCTTCAGTACCCCTTTTCCTATCACTGAATCTCCTG
TTGTTTGCTGTTGTAAGTGGAACCAATGATACTGGAAATTGCGTTGGTTCTCAACAAACATGCTCAATAGATACTTTGAAACTTGGTGTG
TGTGCTAATATACTTAATTTGGTGAATGTAATAGTCGGGTCTCCACCAACTXTTGCCATGCTGCAGTTTGATCCAGGGACTGACGGACCT
AGAGGCCGCGGTTTGCTTGtGCACAGCCATAAAAGCAAATGTGCTGGGAATTAATTTGAATGTACCACTCTCTCTGAGCCTCATACTAAA
CACATGTGGAAAGAAATATCCTACTGGCTTCACTTGTTAA(3')ACTACGTATCCTCCACTCTGCCTCATTAATTTCCAAGGGGTTAATA
AATAAATAAATAAATGTATCGTCGTGCTTATGAAATTATTATGCACGTACGAACCTTTTTAAAAAAAAATTTAAATAAGTGAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan