ESTScan Details for Unigene SGN-U319484

Score 
897
Direction 
Forward
Predicted Peptide Sequence 
MAEMNGNSETQFQIPKIKFTKLFINGEFVDSVSGNTFETIDPRNEEVIARISEGDKEDIDLAVKAAREAFDNGPWPRLSAAERRRIMLKF
ADLIIENAEEIAALDAMDAGKLFVPVKNMDIPAAAEIIRYYAGAADKIHGTTLKMSREMQGYTLLEPIGVVGHIIPWNFPTQMFLMKVGP
ALAAGCTMIVKPAEQTPLSALYYAQLAKQAGVPDGVINVVTGFGSTAGAAXLLAYGRRQDKLHRFDRSRTSSNAAAALSNLKPVSLELGG
KSPFIVFDDVDVDKVAPLALVGILFNKGEICVAGSRLFIQEGIYDKFVKKLEQMVKTWX
Predicted Coding Sequence 
ATGGCGGAAATGAATGGAAATTCAGAAACTCAATTCCAAATTCCGAAAATTAAGTTCACAAAGCTGTTCATCAATGGTGAATTCGTCGAT
TCCGTTTCAGGAAATACGTTTGAAACAATAGATCCACGAAACGAGGAGGTTATCGCAAGAATTAGTGAAGGCGACAAGGAGGATATTGAT
TTGGCTGTCAAAGCCGCCCGTGAAGCTTTCGATAATGGGCCTTGGCCTCGATTATCCGCCGCGGAGAGGAGAAGGATAATGCTGAAATTC
GCGGATTTAATCATAGAAAATGCAGAGGAAATAGCGGCATTGGATGCAATGGATGCAGGGAAGTTATTTGTTCCTGTAAAGAACATGGAC
ATTCCAGCTGCAGCCGAAATTATTCGCTATTATGCTGGTGCAGCCGATAAAATCCATGGAACGACTCTCAAAATGTCGCGTGAGATGCAA
GGATACACGTTGCTCGAACCAATTGGTGTTGTCGGACACATTATTCCTTGGAATTTCCCAACTCAGATGTTTCTTATGAAGGTTGGCCCT
GCATTAGCAGCTGGTTGCACTATGATTGTCAAACCTGCTGAACAAACTCCTCTTTCCGCGCTCTATTATGCTCAATTGGCTAAACAAGCA
GGTGTTCCCGATGGAGTGATCAATGTCGTTACAGGATTTGGTTCTACTGCTGGTGCTGCAXCTTTGCTCGCATATGGACGTAGACAAGAT
AAGCTTCACAGGTTCGACAGAAGTAGGACGTCTAGTAATGCAGCTGCAGCATTAAGCAATTTAAAACCTGTCTCGCTAGAATTGGGAGGG
AAGTCGCCTTTTATAGTATTCGATGATGTAGATGTTGACAAAGTTGCACCACTTGCCCTTGTAGGAATCCTATTCAACAAGGGAGAAATT
TGTGTGGCTGGATCTCGTCTTTTCATCCAAGAAGGTATTTACGATAAATTTGTCAAGAAATTGGAACAGATGGTAAAAACATGGGXX
Edits in Original Sequence 
ATACAGAGCAACGCAATTGTAATAGAAGCAAAAAAAAAAAAAACTCAAAGTAAAAAAA(5')ATGGCGGAAATGAATGGAAATTCAGAAA
CTCAATTCCAAATTCCGAAAATTAAGTTCACAAAGCTGTTCATCAATGGTGAATTCGTCGATTCCGTTTCAGGAAATACGTTTGAAACAA
TAGATCCACGAAACGAGGAGGTTATCGCAAGAATTAGTGAAGGCGACAAGGAGGATATTGATTTGGCTGTCAAAGCCGCCCGTGAAGCTT
TCGATAATGGGCCTTGGCCTCGATTATCCGCCGCGGAGAGGAGAAGGATAATGCTGAAATTCGCGGATTTAATCATAGAAAATGCAGAGG
AAATAGCGGCATTGGATGCAATGGATGCAGGGAAGTTATTTGTTCCTGTAAAGAACATGGACATTCCAGCTGCAGCCGAAATTATTCGCT
ATTATGCTGGTGCAGCCGATAAAATCCATGGAACGACTCTCAAAATGTCGCGTGAGATGCAAGGATACACGTTGCTCGAACCAATTGGTG
TTGTCGGACACATTATTCCTTGGAATTTCCCAACTCAGATGTTTCTTATGAAGGTTGGCCCTGCATTAGCAGCTGGTTGCACTATGATTG
TCAAACCTGCTGAACAAACTCCTCTTTCCGCGCTCTATTATGCTCAATTGGCTAAACAAGCAGGTGTTCCCGATGGAGTGATCAATGTCG
TTACAGGATTTGGTTCTACTGCTGGTGCTGCAXCTTTGCTCGCATATGGACGTAGACAAGATAAGCTTCACAGGTTCGACAGAAGTAGGA
CGTCTAGTAATGCAgGCTGCAGCATTAAGCAATTTAAAACCTGTCTCGCTAGAATTGGGAGGGAAGTCGCCTTTTATAGTATTCGATGAT
GTAGATGTTGACAAAGTTGCACCACTTGCCCTTGTAGGAATCCTATTCAACAAGGGAGAAATTTGTGTGGCTGGATCTCGTCTTTTCATC
CAAGAAGGTATTTACGATAAATTTGTCAAGAAATTGGAACAGATGGTAAAAACATGGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan