ESTScan Details for Unigene SGN-U319623

Score 
984
Direction 
Forward
Predicted Peptide Sequence 
MLKVGMNEMLDVNGTNLELEYVEVDSSKRYGRYKEILGKGATKIVYRAFDELLGMEVAWNQVKLNDMFRSPEELQRLYSEVHLLKELDHE
AIMKFHASWINVEGRTFNFITEMFTSGTLREYRHKYKRLNIHAIKNWGCQILNGLAYLHCHDPPVIHRDLKCDNIFVNGHLGQVKIGDLG
LATILCGSHHAHSVIGTPEFMAPELYEEDYDELVDVYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPKAFYKINDPEAQRFVGRC
LSPVSERPSASELLRDPFLAVDEHEDLPPAINLSCQKYMPNEKQNEIIPFQPDDSVLDGTNMTITGTMX
Predicted Coding Sequence 
ATGCTTAAAGTTGGGATGAATGAAATGCTTGATGTTAATGGAACAAATTTGGAGTTGGAGTATGTGGAAGTGGATTCATCTAAACGCTAT
GGACGTTACAAAGAGATCCTTGGGAAAGGAGCAACCAAGATAGTATACAGAGCATTTGATGAGTTACTAGGAATGGAAGTAGCTTGGAAC
CAAGTGAAACTCAATGACATGTTTAGGTCACCTGAAGAATTACAAAGGCTCTACTCAGAAGTCCATCTCCTCAAAGAACTTGATCATGAA
GCCATCATGAAATTCCATGCATCTTGGATCAATGTTGAAGGCAGAACCTTCAACTTCATTACTGAAATGTTTACCTCTGGCACCCTTAGA
GAGTATAGACACAAATACAAGCGATTAAACATACACGCAATTAAGAATTGGGGATGTCAAATCCTTAATGGTCTTGCTTATTTGCATTGT
CATGATCCTCCAGTTATACATCGAGATCTCAAGTGCGACAACATCTTTGTAAATGGACATCTTGGCCAAGTCAAAATTGGTGATTTAGGA
TTAGCAACCATACTTTGTGGATCACACCATGCTCATAGTGTCATAGGTACTCCTGAGTTTATGGCACCAGAACTATATGAAGAGGATTAT
GATGAACTCGTTGACGTATACTCTTTTGGCATGTGTGTGTTAGAAATGCTCACTTCCGAGTATCCGTATAGTGAATGTTCAAATCCAGCT
CAAATATACAAGAAAGTCACCTCAGGAAAGCTACCAAAAGCGTTTTACAAGATAAATGATCCAGAAGCCCAAAGATTTGTTGGAAGATGT
TTGAGTCCTGTTTCTGAAAGGCCATCTGCTTCTGAGCTATTAAGGGATCCATTCCTTGCTGTTGATGAACATGAAGATTTACCTCCAGCC
ATAAATTTGTCATGTCAAAAGTATATGCCAAACGAAAAACAGAATGAAATTATACCTTTTCAGCCTGATGATTCAGTACTAGATGGTACA
AACATGACAATCACCGGAACAATGAAX
Edits in Original Sequence 
GCCTCGGATTCAATAGCATTAGCTTATCTATTATCTTTTTAATTACATCAAGAGAAACTACATTAGTTTTGTGTTTTTGTTCTAATAAAG
TTTAGTGATAATCATATATATATAGAGAGAGAGAGAAAGTAGTTGCTTGTTAAATATATTTTGTTGGAGTTGTTTGCTTCTTTGTGTATG
TATAAGGATTTGGTTGAAC
(5')ATGCTTAAAGTTGGGATGAATGAAATGCTTGATGTTAATGGAACAAATTTGGAGTTGGAGTATGTGG
AAGTGGATTCATCTAAACGCTATGGACGTTACAAAGAGATCCTTGGGAAAGGAGCAACCAAGATAGTATACAGAGCATTTGATGAGTTAC
TAGGAATGGAAGTAGCTTGGAACCAAGTGAAACTCAATGACATGTTTAGGTCACCTGAAGAATTACAAAGGCTCTACTCAGAAGTCCATC
TCCTCAAAGAACTTGATCATGAAGCCATCATGAAATTCCATGCATCTTGGATCAATGTTGAAGGCAGAACCTTCAACTTCATTACTGAAA
TGTTTACCTCTGGCACCCTTAGAGAGTATAGACACAAATACAAGCGATTAAACATACACGCAATTAAGAATTGGGGATGTCAAATCCTTA
ATGGTCTTGCTTATTTGCATTGTCATGATCCTCCAGTTATACATCGAGATCTCAAGTGCGACAACATCTTTGTAAATGGACATCTTGGCC
AAGTCAAAATTGGTGATTTAGGATTAGCAACCATACTTTGTGGATCACACCATGCTCATAGTGTCATAGGTACTCCTGAGTTTATGGCAC
CAGAACTATATGAAGAGGATTATGATGAACTCGTTGACGTATACTCTTTTGGCATGTGTGTGTTAGAAATGCTCACTTCCGAGTATCCGT
ATAGTGAATGTTCAAATCCAGCTCAAATATACAAGAAAGTCACCTCAGGAAAGCTACCAAAAGCGTTTTACAAGATAAATGATCCAGAAG
CCCAAAGATTTGTTGGAAGATGTTTGAGTCCTGTTTCTGAAAGGCCATCTGCTTCTGAGCTATTAAGGGATCCATTCCTTGCTGTTGATG
AACATGAAGATTTACCTCCAGCCATAAATTTGTCATGTCAAAAGTATATGCCAAACGAAAAACAGAATGAAATTATACCTTTTCAGCCTG
ATGATTCAGTACTAGATGGTACAAACATGACAATCACCGGAACAATGAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan