ESTScan Details for Unigene SGN-U319675

Score 
1230
Direction 
Reverse
Predicted Peptide Sequence 
TRKVSKFVLGQDLEGTGENLTRSGALLSLAEGEEGFLPASEETDEVFGIIDSGSSLTVGQEVNVRVLRIARGQVTLTMKKEEAASELDSK
LNQGVVYSATNPFLLAFRSNKEISSFLDEREKEDEQAEQSKEDAQESDAATIKIDVLPETTSIEEESVNAANDGVPETINGEETKQNVDE
EVESAPEGSTSTIGQQAEVSPVGDAEETEAETGSYEQAADQISASETVVGEEVVEKLTDDNVNVVATEIPSVTEAVKETEETSASENDSI
SSPTGQSEASLENSKDEGV
Predicted Coding Sequence 
XGCACGAGGAAAGTCTCAAAGTTTGTTTTGGGGCAAGATCTTGAGGGCACTGGAGAGAATCTAACCAGGTCTGGTGCTCTCCTATCTCTT
GCTGAAGGAGAGGAAGGGTTCCTGCCAGCATCAGAGGAAACTGATGAAGTGTTTGGAATTATTGACAGTGGCTCTTCACTAACAGTAGGC
CAAGAAGTTAATGTCCGTGTATTGCGCATTGCCAGAGGACAGGTAACTTTGACCATGAAAAAAGAAGAAGCTGCTTCAGAGTTGGACTCA
AAGCTCAACCAGGGTGTTGTCTATTCGGCAACAAATCCCTTTTTATTGGCTTTCCGTAGCAACAAAGAGATCTCTTCATTTTTGGATGAG
AGGGAAAAAGAAGACGAACAAGCTGAACAATCAAAGGAAGATGCACAGGAATCAGATGCGGCGACTATTAAAATAGACGTGTTGCCTGAA
ACTACAAGCATAGAGGAAGAATCAGTAAATGCTGCAAATGATGGTGTTCCGGAAACTATAAATGGGGAGGAGACGAAACAAAACGTTGAT
GAAGAAGTGGAGTCAGCTCCTGAAGGAAGCACATCCACAATTGGTCAGCAAGCTGAGGTGTCACCTGTAGGAGATGCTGAGGAAACTGAA
GCTGAAACTGGCTCATATGAGCAAGCAGCTGATCAGATCTCAGCATCTGAAACTGTGGTGGGTGAGGAGGTCGTAGAGAAACTAACTGAT
GATAATGTAAATGTGGTTGCAACTGAAATACCAAGTGTCACAGAGGCTGTCAAAGAAACAGAGGAAACTAGTGCCAGTGAGAATGATAGT
ATATCAAGCCCAACTGGGCAATCTGAAGCTTCTTTGGAGAATAGCAAGGATGAAGGTGTCTAA
Edits in Original Sequence 
(5')XGCACGAGGAAAGTCTCAAAGTTTGTTTTGGGGCAAGATCTTGAGGGCACTGGAGAGAATCTAACCAGGTCTGGTGCTCTCCTATC
TCTTGCTGAAGGAGAGGAAGGGTTCCTGCCAGCATCAGAGGAAACTGATGAAGTGTTTGGAATTATTGACAGTGGCTCTTCACTAACAGT
AGGCCAAGAAGTTAATGTCCGTGTATTGCGCATTGCCAGAGGACAGGTAACTTTGACCATGAAAAAAGAAGAAGCTGCTTCAGAGTTGGA
CTCAAAGCTCAACCAGGGTGTTGTCTATTCGGCAACAAATCCCTTTTTATTGGCTTTCCGTAGCAACAAAGAGATCTCTTCATTTTTGGA
TGAGAGGGAAAAAGAAGACGAACAAGCTGAACAATCAAAGGAAGATGCACAGGAATCAGATGCGGCGACTATTAAAATAGACGTGTTGCC
TGAAACTACAAGCATAGAGGAAGAATCAGTAAATGCTGCAAATGATGGTGTTCCGGAAACTATAAATGGGGAGGAGACGAAACAAAACGT
TGATGAAGAAGTGGAGTCAGCTCCTGAAGGAAGCACATCCACAATTGGTCAGCAAGCTGAGGTGTCACCTGTAGGAGATGCTGAGGAAAC
TGAAGCTGAAACTGGCTCATATGAGCAAGCAGCTGATCAGATCTCAGCATCTGAAACTGTGGTGGGTGAGGAGGTCGTAGAGAAACTAAC
TGATGATAATGTAAATGTGGTTGCAACTGAAATACCAAGTGTCACAGAGGCTGTCAAAGAAACAGAGGAAACTAGTGCCAGTGAGAATGA
TAGTATATCAAGCCCAACTGGGCAATCTGAAGCTTCTTTGGAGAATAGCAAGGATGAAGGTGTCTAA(3')TAAGAAATTTTCCAGTCTC
CCCTCTGATTTATTACATCCTTTCATTCTCGCTTGCATATTTATGAGAAACAATTAGATACAACTATTTCAACGTTTAGACAATTTTGTT
ATCCAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan