ESTScan Details for Unigene SGN-U319726

Score 
450
Direction 
Forward
Predicted Peptide Sequence 
MSQTVVLKVGMSCEGCVGAVKRVLGKMEGVETFDIDLKEQKVTVKGNVQPDAVLKTVSKTGKPTSFWEAGESAQTEAVSTA
Predicted Coding Sequence 
ATGTCTCAGACTGTCGTTCTCAAGGTTGGCATGTCATGCGAAGGCTGTGTTGGTGCTGTGAAAAGGGTTTTGGGGAAAATGGAAGGTGTA
GAAACTTTCGACATTGATCTGAAGGAGCAAAAGGTGACTGTGAAGGGCAATGTTCAACCAGATGCTGTTCTCAAGACTGTGTCAAAGACT
GGAAAGCCAACATCTTTCTGGGAAGCAGGCGAATCGGCTCAAACAGAAGCTGTTAGTACAGCTTGA
Edits in Original Sequence 
AAAAGGTCAATTTTTTTCTCTCAAACTTTGTATATCACCAATTTTTTTCTCTTGAAAAACCTCACAAGCTTCTTCTCAATTCAACCTCAT
C
(5')ATGTCTCAGACTGTCGTTCTCAAGGTTGGCATGTCATGCGAAGGCTGTGTTGGTGCTGTGAAAAGGGTTTTGGGGAAAATGGAAG
GTGTAGAAACTTTCGACATTGATCTGAAGGAGCAAAAGGTGACTGTGAAGGGCAATGTTCAACCAGATGCTGTTCTCAAGACTGTGTCAA
AGACTGGAAAGCCAACATCTTTCTGGGAAGCAGGCGAATCGGCTCAAACAGAAGCTGTTAGTACAGCTTGA(3')TGGTGTATAATGACT
TGGAATTGTATGTTAAGGCTTGAGCAATATATGACTTTATCAAGAATTCTCCTATGTAATAGTTTGAAATCAGAATTGCAATAAGTTGTT
TGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTGGTGGGGGGGGGGGGGGCCCCCCACCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan