ESTScan Details for Unigene SGN-U319986

Score 
720
Direction 
Forward
Predicted Peptide Sequence 
GVNDKFINGKSNGGTVNGEKAMVTPVIRASLEKQGYKIIGTHSGGNFVDGQNHNLEGAEVAISTHFMALRVTGXMEATPSLACANKCVFC
WRHHTNPVGKSWTWKMDDPIEIVNTAIDLHTKMIKQMKGVPGVKAERLSEGLSPRHCALSLVGEPIMYPEINSLVDELHRRRISTFLVTN
AQFPDKIKLLKPITQLYVSVDAGTKDSLKAIDRPLFGDFWERFLDSLRALKEKEQRTVYRLTLVKGWNTEDVDAYSSLFSIGKPDFIEIK
GVTYCGTSATSKLTMENVPWHSDVKEFSEALAKKSNGEYEVACEQCIPAXVLLAKVDKFKIDGQWFTWIDYEKFHDLVASGKPFTSKDYM
TPTPSWAVYGAEEGGFDPEQLRFKKEGTTDHLVGKMVLEMLKQVFVTSGMA
Predicted Coding Sequence 
XXAGGAGTTAACGATAAGTTCATTAATGGGAAGTCGAATGGTGGAACTGTGAATGGAGAGAAGGCAATGGTAACTCCAGTTATTAGAGCG
AGTTTGGAGAAACAGGGATATAAAATAATTGGCACGCATAGCGGTGGAAACTTTGTAGATGGACAAAATCACAACTTAGAGGGCGCGGAG
GTTGCTATAAGCACTCATTTTATGGCATTGAGAGTCACAGGTGXCATGGAGGCCACTCCTAGTTTAGCATGTGCAAACAAATGTGTTTTT
TGTTGGAGACATCACACAAATCCTGTTGGGAAGAGCTGGACATGGAAGATGGATGATCCTATTGAGATTGTGAACACAGCTATAGATTTG
CATACCAAAATGATAAAACAGATGAAAGGCGTTCCAGGTGTTAAAGCTGAGCGTTTGTCTGAGGGTCTTTCTCCTAGGCATTGTGCTTTG
TCACTGGTTGGTGAGCCTATTATGTATCCAGAAATAAATTCACTTGTAGATGAGCTGCACAGGAGGCGGATTTCGACTTTTCTTGTTACT
AATGCACAGTTCCCTGACAAGATTAAGTTATTGAAACCAATCACACAGTTGTATGTCAGCGTAGATGCAGGTACAAAGGACAGCTTAAAA
GCAATTGACAGACCACTATTTGGAGACTTCTGGGAGCGATTTCTTGATTCTTTGAGAGCTCTTAAGGAGAAGGAGCAAAGAACTGTCTAT
CGTTTGACACTCGTTAAAGGGTGGAACACAGAAGATGTGGATGCATATTCTAGCCTATTCAGCATTGGGAAACCCGATTTCATTGAAATC
AAAGGTGTCACTTATTGTGGAACGTCGGCTACATCAAAGTTGACAATGGAGAATGTCCCTTGGCATTCTGATGTGAAGGAATTCTCTGAA
GCCTTGGCTAAAAAGAGCAACGGAGAGTATGAGGTTGCCTGTGAGCAGTGCATTCCTGCTGXTGTTCTTCTGGCTAAAGTCGATAAGTTC
AAAATAGACGGTCAATGGTTCACGTGGATAGACTACGAGAAGTTCCATGATCTGGTAGCTTCTGGGAAACCCTTTACAAGTAAAGATTAC
ATGACACCCACACCATCTTGGGCTGTCTATGGAGCTGAGGAAGGTGGTTTTGACCCAGAGCAATTGCGTTTCAAAAAAGAGGGCACCACA
GATCATCTCGTCGGGAAAATGGTTCTTGAAATGTTGAAGCAGGTTTTCGTTACCTCTGGGATGGCCTAA
Edits in Original Sequence 
(5')XXAGGAGTTAACGATAAGTTCATTAATGGGAAGTCGAATGGTGGAACTGTGAATGGAGAGAAGGCAATGGTAACTCCAGTTATTAG
AGCGAGTTTGGAGAAACAGGGATATAAAATAATTGGCACGCATAGCGGTGtGAAACTTTGTAGATGGACAAAATCACAACTTAGAGGGCG
CGGAGGTTGCTATAAGCACTCATTTTATGGCATTGAGAGTCACAGGTGXCATGGAGGCCACTCCTAGTTTAGCATGTGCAAACAAATGTG
TTTTTTGTTGGAGACATCACACAAATCCTGTTGGGAAGAGCTGGACATGGAAGATGGATGATCCTATTGAGATTGTGAACACAGCTATAG
ATTTGCATACCAAAATGATAAAACAGATGAAAGGCGTTCCAGGTGTTAAAGCTGAGCGTTTGTCTGAGGGTCTTTCTCCTAGGCATTGTG
CTTTGTCACTGGTTGGTGAGCCTATTATGTATCCAGAAATAAATTCACTTGTAGATGAGCTGCACAGGAGGCGGATTTCGACTTTTCTTG
TTACTAATGCACAGTTCCCTGACAAGATTAAGTTATTGAAACCAATCACACAGTTGTATGTCAGCGTAGATGCAGGTACAAAGGACAGCT
TAAAAGCAATTGACAGACCACTATTTGGAGACTTCTGGGAGCGATTTCTTGATTCTTTGAGAGCTCTTAAGGAGAAGGAGCAAAGAACTG
TCTATCGTTTGACACTCGTTAAAGGGTGGAACACAGAAGATGTGGATGCATATTCTAGCCTATTCAGCATTGGGAAACCCGATTTCATTG
AAATCAAAGGTGTCACTTATTGTGGAACGTCGGCTACATCAAAGTTGACAATGGAGAATGTCCCTTGGCATTCTGATGTGAAGGAATTCT
CTGAAGCCTTGGCTAAAAAGAGCAACGGAGAGTATGAGGTTGCCTGTGAGCAcGTGCATTCCTGCTGXTGTTCTTCTGGCTAAAGTCGAT
AAGTTCAAAATAGACGGTCAATGGTTCACGTGGATAGACTACGAGAAGTTCCATGATCTGGTAGCTTCTGGGAAACCCTTTACAAGTAAA
GATTACATGACACCCACACCATCTTGGGCTGTCTATGGAGCTGAGGAAGGTGGTTTTGACCCAGAGCAATTGCGTTTCAAAAAAGAGcGG
CACCACAGATCATCTCGTCGGGAAAATGGTTCTTGAAATGTTcGAAGCAGGTTTTCGTTACCTCTGGGATGGCCTAA(3')AATTTTGTT
CCTTCGACTTAGATTTTGCTTTCCTCCATTTTCCTATACAAGTTGCATTTCACTATATAACTGCAGAAGTTGTCACTGATATGAAAAATA
TTGCTTGTATGAACACTTCGTATGTTGTTTCATACACAAATTTTTAATTAATTTTGATTATATAAAACGATTGGAAGATACTTGGTTTAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan