ESTScan Details for Unigene SGN-U320095

Score 
575
Direction 
Forward
Predicted Peptide Sequence 
KRKRKGALFAEFIHEKKANXKLLYFDQEENGGLSLALQAEVHSTKIGGLCGLSIELRPYAKRTKPSIKXNGLEEVPSSPGLTQDGDKSFS
SHFSDAYAVFIFSFYFVAFGFHTLSYKLGHLPSDYSQFISCQKSLFIVDANLIYDPGMTASLISAXKFFATSLQEDSSKTGKVTSAGMYF
LGFPVYHMDQTQTSAAATKDPDSAFFKKLDGFQPCEITELKAGTHVFAIYGDNFFKSVSYTIEVVCAEPFTEEKENLRAVEAQILSKRVE
LSKFETEYREVLTQFTEMTSRYAQEMQAIDELLKHRNEIHASYTTLPVMKRSSSSSNRSKNKSGSKAASEDGSVKEKKPLRDRTKKKKWF
NIPLKVDKRKAVLIRFIEKHGXLNEXVAELHFSFSPSNEPIAGLQEFFQRDFIAVARHHYCPEILLILWNGVYTGSTRKILSSNAHTCKL
HYSITSLS
Predicted Coding Sequence 
AAAAGGAAGCGAAAGGGGGCCTTGTTTGCCGAGTTCATTCACGAGAAAAAAGCAAATXTTAAGCTATTGTACTTTGACCAAGAAGAAAAT
GGTGGACTAAGCCTTGCATTACAGGCTGAAGTTCACTCGACAAAGATTGGGGGACTTTGTGGCTTAAGCATTGAGCTCAGGCCTTACGCC
AAGCGAACTAAGCCTAGTATTAAGXTGAATGGTCTAGAGGAGGTGCCATCATCCCCGGGTTTGACTCAAGATGGGGACAAAAGTTTCTCC
AGTCACTTTTCTGACGCATATGCTGTGTTCATATTTTCTTTCTATTTTGTGGCATTTGGTTTTCATACGCTCTCATATAAGCTAGGCCAT
CTTCCCTCAGATTACTCGCAGTTCATCAGTTGCCAAAAATCACTCTTCATTGTTGATGCTAATCTGATTTATGATCCTGGCATGACTGCT
TCATTAATATCTGCTGXTAAATTTTTTGCGACTTCTTTGCAGGAAGATAGTTCAAAAACAGGGAAAGTCACATCTGCTGGCATGTATTTT
CTTGGTTTCCCAGTATATCACATGGATCAAACCCAGACATCGGCAGCAGCCACAAAGGATCCGGACTCTGCATTTTTCAAGAAACTGGAT
GGATTTCAACCATGCGAGATAACTGAGCTCAAAGCTGGCACACATGTTTTTGCAATTTATGGTGACAATTTTTTTAAAAGTGTGAGCTAC
ACCATTGAAGTGGTCTGCGCTGAACCTTTTACTGAGGAAAAAGAGAATCTTAGAGCAGTAGAAGCTCAGATTTTGTCAAAAAGAGTAGAA
CTGTCTAAGTTTGAAACAGAATATAGGGAGGTCTTAACACAATTTACTGAGATGACAAGTAGATATGCTCAAGAAATGCAAGCTATTGAT
GAGCTTCTTAAGCACCGCAATGAAATTCATGCTTCCTATACAACTCTTCCCGTGATGAAACGTAGTAGTAGCAGCAGCAATCGAAGTAAG
AACAAAAGTGGATCCAAGGCAGCCAGTGAAGATGGCTCAGTAAAAGAAAAGAAGCCTTTAAGAGACCGGACAAAGAAGAAGAAATGGTTC
AACATTCCCTTAAAAGTTGACAAGAGGAAAGCXGTGTTAATTAGGTTTATAGAGAAACACGGTAAXCTGAATGAGXTAGTTGCGGAGTTA
CACTTTTCTTTTAGTCCAAGCAACGAACCTATTGCAGGACTTCAAGAATTCTTTCAAAGGGACTTCATTGCAGTAGCTAGGCATCACTAT
TGCCCTGAAATATTGTTAATTTTATGGAATGGTGTTTACACGGGAAGCACACGAAAAATTCTTTCCTCGAACGCTCACACATGTAAATTG
CATTATTCAATCACAAGTCTTTCTTGA
Edits in Original Sequence 
(5')AAAAGGAAGCGAAAGGGGGCCTTGTTTGCCGAGTTCATTCACGAGAAAAAAGCAAATXTTAAGCTATTGTACTTTGACCAAGAAGA
AAATGGTGGACTAAGCCTTGCATTACAGGCTGAAGTTCACTCGACAAAGATTGGGGGACTTTGTGGCTTAAGCATTGAGCTCAGGCCTTA
CGCCAAGCGAACTAAGCCTAGTATTAAGXTGAATGGTCTAGAGGAGGTGCCATCATCCCCGGGTTTGACTCAAGATGGGGACAAAAGTTT
CTCCAGTCACTTTTCTGACGCATATGCTGTGTTCATATTTTCTTTCTATTTTGTGGCATTTGGTTTTCATACGCTCTCATATAAGCTAGG
CCATCTTCCCTCAGATTACTCGCAGTTCATCAGTTGCCAAAAATCACTCTTCATTGTTGATGCTAATCTGATTTATGATCCTGGCATGAC
TGCTTCATTAATATCTGCTGXTAAATTTTTTGCGACTTCTTTGCAGGAAGATAGTTCAAAAACAGGGAAAGTCACATCTGCTGGCATGTA
TTTTCTTGGTTTCCCAGTATATCACATGGATCAAACCCAGACATCGGCAGCAGCCACAAAGGATCCGGACTCTGCATTTTTCAAGAAACT
GGATGGATTTCAACCATGCGAGATAACTGAGCTCAAAGCTGGCACACATGTTTTTGCAATTTATGGTGACAATTTTTTTAAAAGTGTGAG
CTACACCATTGAAGTGGTCTGCGCTGAACCTTTTACTGAGGAAAAAGAGAATCTTAGAGCAGTAGAAGCTCAGATTTTGTCAAAAAGAGT
AGAACTGTCTAAGTTTGAAACAGAATATAGGGAGGTCTTAACACAATTTACTGAGATGACAAGTAGATATGCTCAAGAAATGCAAGCTAT
TGATGAGCTTCTTAAGCACCGCAATGAAATTCATGCTTCCTATACAACTCTTCCCGTGATGAAACGTAGTAGTAGCAGCAGCAATCGAAG
TAAGAACAAAAGTGGATCCAAGGCAGCCAGTGAAGATGGCTCAGTAAAAGAAAAGAAGCCTTTAAGAGACCGGACAAAGAAGAAGAAATG
GTTCAACATTCCCTTAAAAGTTGACAAGAGGAAAGCXGTGTTAATTAGGTTTATAGAGAAACACGGTAAXCTGAATGAGXTAGTTGCGGA
GTTACACTTTTCTTTTAGTCCAAGCAACGAACCTATTGCAGGACTTCAAGAATTCTTTCAAAGGGACTTCATTGCAGTAGCTAGGCATCA
CTATTGCCCTGAAATATTGTTAATTTTATGGAATGGTGTTTACACGGGAAGCACACGAAAAATTCTTTCCTCGAACGCTCACACATGTAA
ATTGCATTATTCAATCACAAGTCTTTCTTGA(3')TTGTGCTATGCTTGTGTGTGTTTTTATGTGGTAAAAAAAGTTGGTACTTTTGTTA
GTTCAGACAGAGAACTAAATACAAAAGAGTGAAGGATACAATATTGTTGCTCTTTTAGCCTCAGATGCCAAATATGTATATTATAAGTCA
AGTATTTACATCTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan