ESTScan Details for Unigene SGN-U320191

Score 
1656
Direction 
Forward
Predicted Peptide Sequence 
DVIEKSNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIRIEALQNRASPETESVFDDTFWENLSVVVNALDNVNARLYIDQRCLYFQKPL
LESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPTEVNAYLINPTDYISSMQKAGDAQA
RDILDRVLECLDKERCDSFEDCITWARLRFEDYFADRVKQLTYTFPEDAATSSGAPFWSAPKRFPRPLQFSVDDASHLQFLLAASMLRAE
TFGISIPDWVNSPQKLAEAVDKVMVPDFQPKKDVKIVTDEKATSMSASSIDDAAVINELVMQLETCRQKLPSGYKMNPIQFEKDDDTNYH
MDFIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLNGGHKVEDYRNTFANLALPLFSMAEPVPPKVIKHQ
DMSWTVWDRWILKDNPTLRELLQWLQNKGLNAYASLTGAAYFITACSLSIKSGWIGKWWNWXKEVAKADLPPYRKHFDVVVACEDDEDND
VDIPQVSIYFR
Predicted Coding Sequence 
GATGTCATTGAGAAGAGTAATCTCAGTAGGCAATTCCTCTTCCGTGACTGGAACATTGGGCAAGCCAAATCTACTGTTGCTGCTGCCGCT
GCTTCTTTGATCAATCCTCGCATTCGCATTGAAGCACTGCAAAACCGCGCAAGCCCTGAAACAGAAAGTGTATTTGATGATACGTTCTGG
GAGAATTTGAGTGTTGTGGTCAATGCACTAGATAATGTGAATGCCAGGCTTTACATTGATCAGAGATGTTTGTATTTTCAAAAACCGTTA
TTGGAGTCTGGGACCCTGGGTGCCAAGTGCAACACTCAGATGGTGATTCCTCACCTTACAGAAAATTATGGTGCATCAAGGGATCCACCA
GAAAAACAAGCACCTATGTGTACAGTTCACTCTTTCCCTCACAACATCGACCATTGCTTAACATGGGCCCGCTCAGAATTTGAGGGCTTG
CTAGAGAAGACACCAACTGAAGTTAATGCTTATCTGATCAATCCTACCGATTACATATCTTCTATGCAAAAGGCTGGTGATGCACAGGCC
AGGGACATTTTGGATCGTGTTCTTGAGTGCCTCGACAAAGAGAGATGTGATTCATTTGAGGACTGCATAACCTGGGCTCGCCTGAGGTTT
GAAGATTACTTTGCAGACCGTGTTAAGCAGTTGACATATACTTTTCCTGAGGATGCCGCTACAAGTAGTGGTGCTCCATTCTGGTCAGCA
CCAAAACGTTTCCCTCGACCATTGCAATTTTCTGTTGATGATGCCAGTCATCTTCAATTTCTCCTGGCAGCCTCTATGTTACGAGCAGAA
ACATTTGGCATTTCCATTCCAGATTGGGTGAACTCTCCTCAAAAGTTAGCTGAAGCTGTTGATAAAGTGATGGTCCCTGATTTCCAGCCA
AAGAAAGATGTGAAGATTGTGACAGATGAGAAAGCAACCAGCATGTCGGCATCATCCATAGATGATGCTGCAGTCATAAACGAGTTGGTG
ATGCAGCTGGAAACGTGTCGTCAGAAATTACCTTCAGGTTACAAGATGAATCCCATTCAATTTGAAAAGGACGATGACACCAACTATCAT
ATGGACTTCATTGCTGGACTTGCAAACATGAGGGCTAGAAACTATAGCATCCCTGAAGTGGATAAACTGAAGGCCAAATTCATAGCAGGG
AGGATCATTCCAGCAATTGCTACTTCTACTGCTATGGCCACTGGTCTTGTTTGTCTTGAGCTTTATAAGGTTTTGAATGGAGGTCATAAG
GTGGAGGACTACCGCAACACTTTTGCCAACTTGGCTCTCCCTTTATTTTCCATGGCTGAACCAGTTCCACCAAAGGTGATCAAGCATCAG
GACATGAGCTGGACTGTGTGGGACAGGTGGATTTTGAAAGACAATCCAACTTTGAGGGAGCTTCTTCAGTGGCTTCAAAACAAAGGTCTG
AATGCTTATGCATCTCTTACGGGAGCTGCTTACTTTATAACAGCATGTTCCCTAAGCATAAAGAGCGGATGGATCGGAAAATGGTGGAAC
TGGCXCAAGGAAGTAGCCAAGGCAGATCTGCCTCCATACAGGAAACATTTTGACGTGGTAGTGGCTTGTGAGGATGATGAAGACAACGAT
GTTGATATCCCTCAAGTCTCTATTTATTTCAGGTAG
Edits in Original Sequence 
(5')GATGTCATTGAGAAGAGTAATCTCAGTAGGCAATTCCTCTTCCGTGACTGGAACATTGGGCAAGCCAAATCTACTGTTGCTGCTGC
CGCTGCTTCTTTGATCAATCCTCGCATTCGCATTGAAGCACTGCAAAACCGCGCAAGCCCTGAAACAGAAAGTGTATTTGATGATACGTT
CTGGGAGAATTTGAGTGTTGTGGTCAATGCACTAGATAATGTGAATGCCAGGCTTTACATTGATCAGAGATGTTTGTATTTTCAAAAACC
GTTATTGGAGTCTGGGACCCTGGGTGCCAAGTGCAACACTCAGATGGTGATTCCTCACCTTACAGAAAATTATGGTGCATCAAGGGATCC
ACCAGAAAAACAAGCACCTATGTGTACAGTTCACTCTTTCCCTCACAACATCGACCATTGCTTAACATGGGCCCGCTCAGAATTTGAGGG
CTTGCTAGAGAAGACACCAACTGAAGTTAATGCTTATCTGATCAATCCTACCGATTACATATCTTCTATGCAAAAGGCTGGTGATGCACA
GGCCAGGGACATTTTGGATCGTGTTCTTGAGTGCCTCGACAAAGAGAGATGTGATTCATTTGAGGACTGCATAACCTGGGCTCGCCTGAG
GTTTGAAGATTACTTTGCAGACCGTGTTAAGCAGTTGACATATACTTTTCCTGAGGATGCCGCTACAAGTAGTGGTGCTCCATTCTGGTC
AGCACCAAAACGTTTCCCTCGACCATTGCAATTTTCTGTTGATGATGCCAGTCATCTTCAATTTCTCCTGGCAGCCTCTATGTTACGAGC
AGAAACATTTGGCATTTCCATTCCAGATTGGGTGAACTCTCCTCAAAAGTTAGCTGAAGCTGTTGATAAAGTGATGGTCCCTGATTTCCA
GCCAAAGAAAGATGTGAAGATTGTGACAGATGAGAAAGCAACCAGCATGTCGGCATCATCCATAGATGATGCTGCAGTCATAAACGAGTT
GGTGATGCAGCTGGAAACGTGTCGTCAGAAATTACCTTCAGGTTACAAGATGAATCCCATTCAATTTGAAAAGGACGATGACACCAACTA
TCATATGGACTTCATTGCTGGACTTGCAAACATGAGGGCTAGAAACTATAGCATCCCTGAAGTGGATAAACTGAAGGCCAAATTCATAGC
AGGGAGGATCATTCCAGCAATTGCTACTTCTACTGCTATGGCCACTGGTCTTGTTTGTCTTGAGCTTTATAAGGTTTTGAATGGAGGTCA
TAAGGTGGAGGACTACCGCAACACTTTTGCCAACTTGGCTCTCCCTTTATTTTCCATGGCTGAACCAGTTCCACCAAAGGTGATCAAGCA
TCAGGACATGAGCTGGACTGTGTGGGACAGGTGGATTTTGAAAGACAATCCAACTTTGAGGGAGCTTCTTCAGTGGCTTCAAAACAAAGG
TCTGAATGCTTATaGCATCTCTTACGGGAGCTGCTTACTTTATAACAGCATGTTCCCTAAGCATAAAGAGCGGATGGATCGGAAAATGGT
GGAACTGGCXCAAGGAAGTAGCCAAGGCAGATCTGCCTCCATACAGGAAACATTTTGACGTGGTAGTGGCTTGTGAGGATGATGAAGACA
ACGATGTTGATATCCCTCAAGTCTCTATTTATTTCAGGTAG(3')ATTGTTTGTTCTTTCCTGTAACCACTCACCGGAGTAGCCTGAAAT
CATAGGGTGACAGTTGATTTTCTCCATGCTATGTTTGGTCTTTCTTGTTGGCAAAAGCTAGATAGATATATTCTATTCTATACTAGCCAG
CCTGCATACAAAGTCAGAACCATATGTTGAGTAGTAAAATTATGACGACTGTTGAACTTCGAGCATCTGATTTATCACATGTCTCCATTT
TCTTGCTCAACTATTTGAAGAAATATAGTTGATGTTGGTTAGTGGATTCGAAGTGATGAACTAACTATTTGCTTTGATCCATAATGTCTA
AATTGCTGCTGCTGTGATATTTACATTTGCAAACTAAAAAAAAAAAAAAAAAACTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan