ESTScan Details for Unigene SGN-U320255

Score 
402
Direction 
Forward
Predicted Peptide Sequence 
LFEELLTFHTLSSDLEMMKVVLKLEYVDEKVKQKVMKKVSVVEGVESMSMDTKDKKLTVVGNVDPVVIVSKLKKLCHTEIVLVGPAKEPE
KKKDNEPKKTEDKKKAAAIKAYPAPVLYQYQYQQPYPQYPTPVPAYQHYYSVEEDSNSCXDLLASHL
Predicted Coding Sequence 
XXTCTATTTGAAGAGCTACTTACTTTCCATACACTTAGTTCAGATCTCGAGATGATGAAAGTAGTGCTGAAGTTGGAGTATGTGGATGAA
AAAGTCAAGCAAAAGGTGATGAAAAAAGTTTCTGTTGTGGAAGGGGTAGAGTCAATGTCGATGGATACAAAGGACAAGAAATTGACAGTA
GTCGGAAATGTAGATCCAGTTGTAATAGTTTCAAAATTGAAGAAACTGTGTCACACTGAGATAGTATTGGTTGGACCAGCAAAAGAGCCG
GAGAAGAAGAAAGATAATGAGCCGAAGAAAACAGAAGACAAAAAGAAAGCGGCAGCGATAAAGGCATATCCAGCTCCAGTTCTCTATCAA
TATCAATATCAACAACCTTATCCACAGTACCCAACCCCTGTTCCTGCTTATCAGCACTATTACAGTGTGGAAGAGGACTCTAACTCTTGT
GXTGATCTGCTAGCTTCACATTTGTGATGA
Edits in Original Sequence 
(5')XXTCTATTTGAAGAGCTACTTACTTTCCATACACTTAGTTCAGATCTCGAGATGATGAAAGTAGTGCTGAAGTTGGAGTATGTGGA
TGAAAAAGTCAAGCAAAAGGTGATGAAAAAAGTTTCTGTTGTGGAAGGGGTAGAGTCAATGTCGATGGATACAAAGGACAAGAAATTGAC
AGTAGTCGGAAATGTAGATCCAGTTGTAATAGTTTCAAAATTGAAGAAACTGTGTCACACTGAGATAGTATTGGTTGGACCAGCAAAAGA
GCCGGAGAAGAAGAAAGATAATGAGCCGAAGAAAACAGAAGACAAAAAGAAAGCGGCAGCGATAAAGGCATATCCAGCTCCAGTTCTCTA
TCAATATCAATATCAACAACCTTATCCACAGTACCCAACCCCTGTTCCTGCTTATCAGCACTATTACAGTGTGGAAGAGGACTCTAACTC
TTGTGXTGATCTGCTAGCTTCACATTTGTGATGA(3')GTTAGTGGACTAGTTCATACAAGCCTCCTTGTTGTACTATATTTGGTTGAAG
AATTGAAATTTAAAGAGGATAATAAGCATTTGAAGCTGAAAAAATAAAAAGTTAGATTTCATATCGTGAACGCTTATTATATTAAGAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan