ESTScan Details for Unigene SGN-U320256

Score 
443
Direction 
Forward
Predicted Peptide Sequence 
YFLLFPSTFSSFEELLTFHTLSSDLEMMKVVLKLEYVDEKVKQKVMKKVSVVEGTFIVQNYVRIPDLAIDLFFVVSDDVAGVESMSMDTK
DKKLTVVGNVDPVVIVSKLKKLCHTEIVLVGPAKEPEKKKDNEPKKTEDKKKAAAIKAYPAPVLYQYQYQQPYPQYPTPVPAYQHYYSVE
EDSNSCXDLLASHL
Predicted Coding Sequence 
XTGTATTTCTTACTATTCCCTTCAACATTTTCCTCTTTTGAAGAGCTACTTACTTTCCATACACTTAGTTCAGATCTCGAGATGATGAAA
GTAGTGCTGAAGTTGGAGTATGTGGATGAAAAAGTCAAGCAAAAGGTGATGAAAAAAGTTTCTGTTGTGGAAGGTACTTTTATTGTTCAA
AATTATGTCAGAATTCCAGATCTTGCAATAGATTTATTTTTTGTTGTTTCTGATGATGTTGCAGGGGTAGAGTCAATGTCGATGGATACA
AAGGACAAGAAATTGACAGTAGTCGGAAATGTAGATCCAGTTGTAATAGTTTCAAAATTGAAGAAACTGTGTCACACTGAGATAGTATTG
GTTGGACCAGCAAAAGAGCCGGAGAAGAAGAAAGATAATGAGCCGAAGAAAACAGAAGACAAAAAGAAAGCGGCAGCGATAAAGGCATAT
CCAGCTCCAGTTCTCTATCAATATCAATATCAACAACCTTATCCACAGTACCCAACCCCTGTTCCTGCTTATCAGCACTATTACAGTGTG
GAAGAGGACTCTAACTCTTGTGXTGATCTGCTAGCTTCACATTTGTGATGA
Edits in Original Sequence 
(5')XTGTATTTCTTACTATTCCCTTCAACATTTTCCTCTaTTTGAAGAGCTACTTACTTTCCATACACTTAGTTCAGATCTCGAGATGA
TGAAAGTAGTGCTGAAGTTGGAGTATGTGGATGAAAAAGTCAAGCAAAAGGTGATGAAAAAAGTTTCTGTTGTGGAAGGTACgTTTTATT
GTTCAAAATTATGTCAGAATTCCAGATCTTGCAATAGATTTATTTTTTGTTGTTTCTGATGATGTTGCAGGGGTAGAGTCAATGTCGATG
GATACAAAGGACAAGAAATTGACAGTAGTCGGAAATGTAGATCCAGTTGTAATAGTTTCAAAATTGAAGAAACTGTGTCACACTGAGATA
GTATTGGTTGGACCAGCAAAAGAGCCGGAGAAGAAGAAAGATAATGAGCCGAAGAAAACAGAAGACAAAAAGAAAGCGGCAGCGATAAAG
GCATATCCAGCTCCAGTTCTCTATCAATATCAATATCAACAACCTTATCCACAGTACCCAACCCCTGTTCCTGCTTATCAGCACTATTAC
AGTGTGGAAGAGGACTCTAACTCTTGTGXTGATCTGCTAGCTTCACATTTGTGATGA(3')GTTAGTGGACTAGTTCATACAAGCCTCCT
TGTTGTACTATATTTGGTTGAAGAATTGAAATTTAAAGAGGATAATAAGCATTTGAAGCTGAAAAAAATAAAAAGTTAGATTTCATATCG
TGAACGCTTATTATATTAAGAATACAAATTGTGTTTTGATTGAATTTCACCTCGAAATATATAGGACTGAAAGGCTGTATATTGAAGTCA
AGCCACAAATCTTGACACATTATAGTTATCAACGGTTGCAATTGACTTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan