ESTScan Details for Unigene SGN-U320327

Score 
571
Direction 
Forward
Predicted Peptide Sequence 
AEVLAAAKRISESRKAAKAAEETELPDVSDAAPEGAEKAGIDVISTSPNAQLPSGIAAPPVSETASTLASLRMLXRVFENIWTGANGPSW
SSSAGLRTIKRVEQTLQDLGVNLKPKVPTKLVCAEHLELRKEILTLLNLQKQVQYKESEGSSYREGSYSETPGTPPKRAQRATDQDRTFI
PDSTSFGGERAGKKDQKRKGPGRLSEVPSSPAQSKRPRKLKLQMDELEGLKLQGADKKLLQINFFILCSAAFLNLLHHENMIQPFKTSNV
AAHLSGTKMLDATLMPFYGDQSSFAPEYSPR
Predicted Coding Sequence 
GCAGAGGTTCTTGCTGCAGCAAAAAGAATATCCGAATCACGAAAAGCTGCTAAGGCCGCTGAAGAAACAGAACTTCCCGATGTGTCAGAT
GCTGCTCCTGAAGGTGCTGAAAAGGCTGGTATTGATGTAATATCAACCTCTCCAAATGCTCAATTACCCTCTGGCATTGCTGCACCTCCA
GTGTCAGAGACTGCTTCCACTTTGGCTTCTCTTCGCATGCTGCXGCGTGTATTTGAGAACATATGGACTGGAGCAAATGGTCCAAGCTGG
AGCTCTTCAGCTGGACTCCGGACAATCAAACGGGTTGAACAAACTTTACAAGACCTTGGGGTTAATTTGAAGCCAAAGGTCCCAACAAAA
CTTGTCTGTGCGGAGCATCTTGAACTGAGGAAAGAGATACTAACCCTGTTAAATCTTCAAAAGCAGGTACAATACAAGGAGTCAGAAGGC
TCATCTTATCGGGAAGGTTCATATTCTGAAACACCTGGTACACCTCCTAAGCGTGCGCAACGTGCTACGGACCAAGATAGAACATTCATT
CCCGATTCTACAAGTTTTGGAGGGGAAAGAGCTGGTAAAAAGGACCAGAAACGCAAGGGGCCTGGACGATTATCAGAAGTACCATCTTCA
CCAGCACAGTCAAAACGGCCTCGCAAGTTAAAACTTCAGATGGATGAATTGGAAGGACTAAAGCTACAAGGAGCTGATAAGAAGCTGCTT
CAAATCAACTTCTTTATCCTGTGTTCTGCXGCCTTTTTGAATTTGCTCCACCATGAAAACATGATCCAGCCTTTCAAAACTTCAAATGTG
GCTGCTCATTTGAGTGGCACAAAAATGTTAGATGCCACTCTAATGCCTTTCTATGGAGATCAGTCCTCCTTTGCACCAGAGTACAGTCCC
CGC
Edits in Original Sequence 
(5')GCAGAGGTTCTTGCTGCAGCAAAAAGAATATCCGAATCACGAAAAGCTGCTAAGGCCGCTGAAGAAACAGAACTTCCCGATGTGTC
AGATGCTGCTCCTGAAGGTGCTGAAAAGGCTGGTATTGATGTAATATCAACCTCTCCAAATGCTCAATTACCCTCTGGCATTGCTGCACC
TCCAGTGTCAGAGACTGCTTCCACTTTGGCTTCTCTTCGCATGCTGCXGCGTGTATTTGAGAACATATGGACTGGAGCAAATGGTCCAAG
CTGcGAGCTCTTCAGCTGGACTCCGGACAATCAAACGGGTTGAACAAACTTTACAAGACCTTGGGGTTAATTTGAAGCCAAAGGTCCCAA
CAAAACTTGTCTGTGCGGAGCATCTTGAACTGAGGAAAGAGATACTAACCCTGTTAAATCTTCAAAAGCAGGTACAATACAAGGAGTCAG
AAGGCTCATCTTATCGGGAAGGTTCATATTCTGAAACACCTGGTACACCTCCTAAGCGTGCGCAACGTGCTACGGACCAAGATAGAACAT
TCATTCCCGATTCTACAAGTTTTGGAGGGGAAAGAGCTGGTAAAAAGGACCAGAAACGCAAGGGGCCTGGACGATTATCAGAAGTACCAT
CTTCACCAGCACAGTCAAAACGGCCTCGCAAGTTaAAAACTTCAGATGGATGAATTGGAAGGACTAAAGCTACAAGGAGCTGtATAAGAA
GCTGCTTCAAATCAACTTCTTTATCCTGTGTTCTGCXGCCTTTTTGAATTTGCTCCACCATGAAAACATGATCCAGCCTTTCAAAACTTC
AAATGTGGCTGtCTCATTTGAGTGGCACAAAAATGTTAGATGCCACTCTAATGCCTTTCTATGGAGATCAgGTCCTCCTTTGCACCAGAG
TACAGTCCCCGC(3')AGTCTGTATATACATCTGTATCTTATAGTTGTGATTAGCATGTTAACCTCACCTTGCTACCGTGTCTCTTTGGC
ATGTCACTAAATTGTTGAGCCGTATTGGCTGTTTCTGTATTAACACATCAAAGTAGTTGTGCTTTAATCGCGTTTAGATTGCTTCCCAGG
AAGGACTGATATGAGTTAACACTGGCACTGCATAGAAGCTGAAACAGAAAGTGTAGTGATTGCGAACCATAATATATCCTTTCTATATGT
TAAGAATTTTATGAAGTTAAATTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan