ESTScan Details for Unigene SGN-U320330

Score 
106
Direction 
Forward
Predicted Peptide Sequence 
ITSFSNPQFHSGSLAELTPNFFIASEKEDDEQNFFISPPDHDNNIVKNATDFQEHGNVFETVPALGNNIISAQDLEPMSKKLKTYAAAWV
HPTRKLATGVDVDGGHNPTWNDKFVFRVDEEFLRHENSAVHIEIYSVHWFRDSLVGTVRVLVGNLIPPIRTHLRTHHHGMRFVALQIRRP
SGRPQGILNIGVSLLDSSMRSMPLYRQMSTSAVAYRDLMEDRNTHHTHNNEIKQNNDSNVDVPKPILRRIKSERSERIALDDISIGNNSS
IVAIPSKTKGIDHEKXEFNN
Predicted Coding Sequence 
XTAATTACCTCCTTCTCTAACCCCCAATTTCATTCGGGGTCTCTAGCXGAATTGACCCCGAACTTTTTCATCGCGTCCGAGAAAGAGGAC
GACGAGCAAAACTTTTTCATTTCACCACCAGATCACGATAATAACATTGTGAAAAATGCCACCGATTTCCAAGAACATGGGAACGTCTTT
GAAACCGTTCCAGCTCTTGGAAATAACATCATTTCCGCGCAGGACTTGGAACCCATGTCAAAGAAATTGAAGACCTACGCGGCCGCATGG
GTCCATCCTACGCGGAAACTTGCCACGGGTGTTGACGTGGACGGTGGCCATAACCCCACGTGGAATGACAAGTTTGTTTTTCGTGTGGAC
GAAGAATTTCTCCGTCATGAGAATTCCGCCGTCCACATCGAGATTTACTCCGTCCATTGGTTCCGTGACTCTCTCGTCGGAACGGTTCGT
GTCCTTGTCGGAAACCTAATCCCTCCGATTCGTACTCACCTCCGTACTCACCATCATGGAATGCGTTTTGTCGCACTTCAGATTCGTCGT
CCATCAGGGCGTCCTCAAGGTATATTGAATATTGGTGTATCTTTACTCGATAGCTCGATGAGGAGTATGCCATTATATAGACAAATGAGC
ACGTCAGCAGTTGCATATCGCGATTTGATGGAAGATCGAAACACACACCATACACACAACAATGAGATCAAGCAGAACAACGATAGTAAT
GTTGATGTTCCAAAACCTATATTACGTCGAATAAAGAGTGAACGTAGCGAACGTATCGCGTTGGATGATATTTCCATAGGTAATAATAGT
TCAATAGTTGCAATTCCTTCAAAAACAAAAGGTATAGATCATGAAAAAGAXGAGTTCAATAATTAG
Edits in Original Sequence 
(5')XTAATTACCTCCTTCTCTAACCCCCAATTTCATTCGGGGTCTCTAGCXGAATTGACCCCGAACTTTTTCATCGCGTCCGAGAAAGA
GGACGACGAGCAAAACTTTTTCATTTCACCACCAcGATCACGATAATAACATTGTGAAAtAATGCCACCGATTTCCAAGAACATGGGAAC
GTCTTTGAAACCGTTCCAGCTCTTGGAAATaAACATCATTTCCGCGCAGGACTTGGAACCCATGTCAAAGAAATTGAAGACCTACGCGGC
CGCATGGGTCCATCCTACGCGGAAACTTGCCACGGGTGTTGACGTGGACGGTGGCCATAACCCCACGTGGAATGACAAGTTTGTTTTTCG
TGTGGACGAAGAATTTCTCCGTCATGAGAATTCCGCCGTCCACATCGAGATTTACTCCGTCCATTGGTTCCGTGACTCTCTCGTCGGAAC
GGTTCGTGTCCTTGTCGGAAACCTAATCCCTCCGATTCGTACTCACCTCCGTACTCACCATCATGGAATGCGTTTTGTCGCACTTCAGAT
TCGTCGTCCATCAGGGCGTCCTCAAGGTATATTGAATATTGGTGTATCTTTACTCGATAGCTCGATGAGGAGTATGCCATTATATAGACA
AATGAGCACGTCAGCAGTTGCATATCGCGATTTGATGGAAGATCGAAACACACACCATACACACAACAATGAGATCAAGCAGAACAACGA
TAGTAATGTTGATGTTCCAAAACCTATATTACGTCGAATAAAGAGTGAACGTAGCGAACGTATCGCGTTGGATGATATTTCCATAGGTAA
TAATAGTTCAATAGTTGCAATTCCTTCAAAAACAAAAGGTATAGATCATGAAAAAGAXGAGTTCAATAATTAG(3')TATTTCATTTGAA
CCTCCAATTCATATGATGAAAAAAAAGGGAAAAGCAAGTTCTGTTATAAATGGAGCTGAGCTAATAAATGAGAAATCAAAATTAGAAAAT
AAAAAAATTAAGACAAGTTCTGTTTTAAGTGATTCAATTGCAAGAAGAAGAATATTGAGGAATTAGGGGGTCTTTTTGTTTAGGTCTCTC
TTTTCATTATTATTTTTTATTTACAATATTGTAATTACTATTCTATCTGATTATTTTTTTTAGTTCTCAAAACTACTGTGCATTGTTATC
AATTTGTAATTGGTAATATGTCTTTTCTTGGAAAAAGAGAAGTTCATTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan