Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U320446

Score 
274
Direction 
Forward
Predicted Peptide Sequence 
PAKIPPKAAMVNFKALSVNLLLLVLLCPASAQPSNSPDSENRFEYPSVSPAMAIIIVILIAALFFIAFFSIYIRNRGAVNGSIGQTFSMR
RRTAAATRGLEDSVIETFPTFTYVEVKDHHIGKGALECAVCLNEFEDDEMLRLIPKCDHVFHPECIDAWLKSHVTCPVCRADLTPKPDEP
VPVQTPEVNRELGQEQENTQQNNEVTIQIDVDENLMSQQEETSVKPEVKRNLSFNXGEPAAEVFFSEETKDVKQIQVTFTGHSLVVPGEN
LDRYTLRLPEKVRKDVMDRALLNRTRSCAVTLPRHGSTTRGYRAGPGEGSNRGARSFKRIDRFDPETKSDRWFLKIAPPFFTRGSSMKSP
KVRADNEEASTSXQQYESSSKIAVLPMPGAKGDEPGLLANDSARXSGLKNVIITDSGLIKRGGKENFLFAGKYGERVVEANGLGPTAFET
SAVDFNAHIYIVPKVEFKVYDF
Predicted Coding Sequence 
XGGCCGGCGAAAATTCCACCAAAAGCTGCCATGGTTAATTTTAAAGCTCTTTCCGTTAATCTCCTCCTATTAGTATTACTATGTCCGGCG
TCAGCTCAGCCATCAAATTCCCCTGATTCCGAGAATCGGTTCGAGTACCCGAGTGTCAGTCCTGCTATGGCAATTATCATAGTGATACTT
ATTGCTGCTCTTTTTTTCATTGCCTTCTTCTCAATTTACATACGCAACCGCGGTGCAGTTAACGGAAGCATCGGTCAAACCTTCTCCATG
CGACGGCGTACTGCTGCTGCTACTCGAGGACTTGAAGATTCCGTCATCGAGACTTTTCCTACCTTTACTTACGTCGAAGTAAAGGATCAT
CATATTGGGAAGGGAGCTTTGGAGTGTGCCGTGTGTCTGAACGAATTTGAAGATGATGAAATGTTGCGTTTGATCCCTAAGTGTGATCAC
GTTTTTCATCCTGAATGCATCGATGCTTGGCTCAAATCTCATGTAACTTGCCCTGTTTGCCGAGCTGATCTTACTCCTAAACCTGATGAA
CCGGTGCCGGTTCAAACTCCTGAGGTGAACCGGGAATTGGGGCAAGAACAGGAGAATACACAGCAAAATAACGAAGTTACGATTCAAATA
GATGTAGATGAGAATTTGATGTCACAGCAAGAGGAGACCTCTGTAAAACCAGAAGTTAAACGAAATTTGAGTTTCAACGXCGGTGAACCG
GCCGCCGAGGTCTTTTTCTCTGAAGAGACCAAAGATGTTAAGCAAATTCAGGTCACATTCACCGGTCACTCATTAGTGGTACCAGGGGAG
AATTTAGACCGGTATACTCTTAGATTGCCGGAGAAGGTGAGGAAAGATGTAATGGACCGGGCTCTACTAAACCGGACAAGGAGCTGTGCA
GTCACGCTACCAAGACACGGTAGCACCACAAGAGGATACAGAGCCGGTCCAGGAGAGGGAAGCAACAGAGGTGCAAGGTCATTCAAGCGA
ATCGACCGGTTCGATCCGGAAACAAAATCAGACCGGTGGTTTCTCAAGATTGCACCGCCATTCTTTACCAGAGGTTCATCAATGAAGTCA
CCAAAAGTAAGAGCTGATAACGAAGAAGCATCCACATCACXGCAGCAATATGAAAGTAGCAGTAAAATTGCCGTCCTTCCAATGCCTGGA
GCCAAAGGTGATGAACCGGGTTTATTGGCAAATGACTCGGCTCGAXTCTCCGGTTTAAAGAATGTTATAATTACTGACTCGGGTTTAATT
AAGCGTGGTGGAAAGGAAAACTTTTTGTTCGCCGGCAAATATGGAGAACGCGTGGTCGAAGCTAATGGGCTGGGCCCCACAGCCTTTGAA
ACTTCCGCTGTTGACTTTAATGCACATATTTATATAGTTCCAAAAGTTGAATTCAAGGTTTACGATTTCTAG
Edits in Original Sequence 
(5')XGGCCGGCGAAAATTcCCACCAAAAGCTGCCATGGTTAATTTTAAAGCTCTTTCCGTTAATCTCCTCCTATTAGTATTACTATGTC
CGGCGTCAGCTCAGCCATCAAATTCCCCTGATTCCGAGAATCGGTTCGAGTACCCGAGTGTCAGTCCTGCTATGGCAATTATCATAGTGA
TACTTATTGCTGCTCtTTTTTTTCATTGCCTTCTTCTCAATTTACATACGCAACCGCGGTGCAGTTAACGGAAGCATCGGTCAAACCTTC
TCCATGCGACGGCGTACTGCTGCTGCTACTCGAGGACTTGAAGATTCCGTCATCGAGACTTTTCCTACCTTTACTTACGTCGAAGTAAAG
GATCATCATATTGGGAAGGGAGCTTTGGAGTGTGCCGTGTGTCTGAACGAATTTGAAGATGATGAAATGTTGCGTTTGATCCCTAAGTGT
GATCACGTTTTTCATCCTGAATGCATCGATGCTTGGCTCAAATCTCATGTAACTTGCCCTGTTTGCCGAGCTGATCTTACTCCTAAACCT
GATGAACCGGTGCCGGTTCAAACTCCTGAGGTGAACCGGGAATTGGGGCAAGAACAGGAGAATACACAGCAAAATAACGAAGTTACGATT
CAAATAGATGTAGATGAGAATTTGATGTCACAGCAAGAGGAGACCTCTGTAAAACCAGAAGTTAAACGAAATTTGAGTTTCAACGXCGGT
GAACCGGCCGCCGAGGTCTTTTTCTCTGAAGAGACCAAAGATGTTAAGCAAATTCAGGTCACATTCgACCGGTCACTCATTAGTGGTACC
AGGGGAGAATTTAGACCGGTATACTCTTAGATTGCCGGAGAAGGTGAGGAAAGATGTAATGGACCGGGCTCTACTAAACCGGACAAGGAG
CTGTGCAGTCACGCTACCAAGACACGGTAGCACCACAAGAGGATACAGAGCCGGTCCAGGAGAGGGAAGCAACAGAGGTGCAAGGTCATT
CAAGCGAATCGACCGGTTCGATCCGGAAACAAAATCAGACCGGTGGTTTCTCAAGATTGCACCGCCATTCTTTACCAGAGGTTCATCAAT
GAAGTCACCAAAAGTAAGAGCTGATAACGAAGAAGCATCCACATCACXGCAGCAATATGAAAGTAGCAGTAAAATTGCCGTCCTTCCAAT
GCCTGGAGCCgAAAGGTGATGAACCGGGTTTATTGGCAAATGACTCGGCTCGAXTCTCCGGTTTAAAGAATGTTATAATTACTGACTCGG
GTTTAATTAAGCGTGGTGGAAAGGtAAAACTTTTTGTTCGCCGGCAAATATGGAGAACGCGTGGTCGAAGCTAATGGGCTGGGCCCCACA
GaCCTTTGAAACTTCCGCTGTTGACTTTAATGCACATATTTATATAGTgTCCAAAAGTTGAATTCAAGGTTTACGATTTCTAG(3')AAT
ATTCTTTAAAATGTTGATTAACTTTTATTGTTCTAAAAAACAAATAATTTTCAACTTTGGGTTTATTTGGGGTGATGAGATGGTGTTTAA
AGAGTTTGAGTTTATCTAGATGGATGATGTAATAATACCTTAAACACCATGTAAATATACCATATGTTTTATTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan