ESTScan Details for Unigene SGN-U320644

Score 
525
Direction 
Forward
Predicted Peptide Sequence 
MENGHESLSNGKPADPGLQIIRHPSYQSSCGKLLLSWLDIRVFYIRVSNFMVDDSTPEYLTLNHIPLSPDTLLEVNGSRCSMYSEGASCL
LRRDRVDKKSEEATFVSTDSIRLTGSVKFEVFNKDDLVLSGFLEMSNSNGFVGESKNSGKRWNMNCESVMNAGTGFLKGKQIMDSESLSP
TIEVFITGCFSGTPXHLDQEFAAQSSX
Predicted Coding Sequence 
ATGGAGAATGGTCATGAATCACTCAGCAATGGAAAACCAGCTGATCCTGGTCTCCAAATTATTAGGCACCCCTCTTACCAATCATCTTGT
GGTAAATTATTGTTATCTTGGTTAGATATAAGAGTTTTCTATATTAGAGTCAGCAATTTTATGGTAGATGATTCCACCCCGGAATATCTT
ACTCTCAACCACATTCCTCTAAGTCCCGATACATTGCTTGAAGTTAATGGATCAAGATGTTCCATGTATTCAGAAGGAGCATCTTGTCTC
CTTCGAAGGGATAGGGTTGATAAGAAATCCGAAGAAGCTACATTTGTGAGCACGGATAGTATAAGGTTGACAGGAAGTGTGAAATTTGAG
GTTTTCAATAAAGATGATCTTGTGCTCTCCGGGTTTTTAGAGATGTCGAATAGTAATGGTTTTGTTGGGGAGTCTAAAAACAGTGGCAAG
AGATGGAACATGAATTGTGAATCGGTGATGAATGCTGGCACTGGTTTCCTGAAGGGTAAACAAATTATGGATTCTGAATCATTATCACCA
ACAATTGAAGTCTTTATTACTGGTTGCTTCTCCGGGACACCTXATCATCTTGACCAAGAATTTGCAGCTCAATCATCGGXX
Edits in Original Sequence 
GGAAAAGGCATATTTTGATGGTAAAATTGAAGAAGATTCCAAAAAGAGTAGCATCACTGTATATTGATTATATTTTAGCTAACCAAACAG
TTTGGTGGAAGTTGATGAGAAAAAACACTTCTTTTTTGGGAAGTCGAAAGTGATTTAAAAGATCTTTGGATGCTTGTATAGAAGTAGAAA
AAATAGAGAGGATTTTCTTGGGTTCTTTGGCCTACGTAGGTCCCGATTCATGGTTCGATTATGTCCTTATATCGGTGTCTGGTGAAGGAT
TCTGTTGAGGATTAAAC
(5')ATGGAGAATGGTCATGAATCACTCAGCAATGGAAAACCAGCTGATCCTGGTCTCCAAATTATTAGGCAC
CCCTCTTACCAATCATCTTGTGGTAAATTATTGTTATCTTGGTTAGATATAAGAGTTTTCTATATTAGAGTCAGCAATTTTATGGTAGAT
GATTCCACCCCGGAATATCTTACTCTCAACCACATTCCTCTAAGTCCCGATACATTGCTTGAAGTTAATGGATCAAGATGTTCCATGTAT
TCAGAAGGAGCATCTTGTCTCCTTCGAAGGGATAGGGTTGATAAGAAATCCGAAGAAGCTACATTTGTGAGCACGGATAGTATAAGGTTG
ACAGGAAGTGTGAAATTTGAGGTTTTCAATAAAGATGATCTTGTGCTCTCCGGGTTTTTAGAGATGTCGAATAGTAATGGTTTTGTTGGG
GAGTCTAAAAACAGTGGCAAGAGATGGAACATGAATTGTGAATCGGTGATGAATGCTGGCACTGGTTTCCTGAAGGGTAAACAAATTATG
GATTCTGAATCATTATCACCAACAATTGAAGTCTTTATTACTGGTTGCTTCTCCGGGACACCTXATCATCTTGACCAAGAATTTGCAGCT
CAATCATCGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan