ESTScan Details for Unigene SGN-U320790

Score 
701
Direction 
Forward
Predicted Peptide Sequence 
NNLFISLTPSWTSVSMLIGFFLYLATVGSILPGKLVPGATLSDGTRLHYRCNGLLSLLLLVLLLGVGSQMNLVSPTAIADRGLELLSTTL
IFSVLVTLMLYLVGLNSRAKSSSLKPHVSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCVIEAKLSQSMILYQLF
CGLYILDYFFYEEFMTSTWDIIAERLGYMLVFGDLVFIPFTFSIQGWWLLSNKVELTTAAIIANCLVFLIGYSVFRGANKQKHVFKKDPK
APIWGSPPKVIGGKLLASGYWGIARHCNYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLVPYX
DLTLRLLAQSFVHVACALESELASLYRTTQA
Predicted Coding Sequence 
XTCAATAATCTCTTCATTTCTCTCACTCCATCATGGACTTCGGTGTCTATGTTGATCGGATTTTTTCTCTATTTAGCTACCGTTGGATCT
ATTCTACCCGGAAAACTTGTTCCTGGGGCGACTTTATCTGATGGAACTCGACTCCATTATCGTTGCAATGGTTTATTATCACTTCTGTTG
TTGGTTTTGCTTCTTGGAGTTGGGTCGCAGATGAATCTTGTTTCACCTACTGCTATAGCAGATAGAGGACTTGAGCTTTTGTCCACAACA
CTTATCTTTAGTGTTCTTGTGACATTGATGCTTTATTTGGTTGGCCTGAACTCACGTGCAAAGAGTTCATCACTGAAACCTCATGTCTCA
GGAAATCTAATCCATGACTGGTGGTTTGGGATACAACTGAATCCTGAATTCATGGGCATTGATCTCAAATTTTTCTTTGTTAGAGCTGGT
ATGATGGGATGGTTACTTATCAATCTTTCAGTTCTTGCAAAATGTGTTATAGAGGCTAAATTGAGCCAATCAATGATTCTCTACCAGCTA
TTTTGTGGGCTCTACATCCTTGACTACTTCTTCTATGAAGAGTTCATGACCTCCACATGGGATATAATAGCAGAGAGGTTGGGCTACATG
CTGGTTTTTGGTGATCTAGTCTTTATACCGTTCACCTTCAGTATTCAGGGTTGGTGGCTTTTGAGTAACAAAGTGGAGCTAACAACAGCA
GCAATAATTGCCAATTGCCTCGTCTTTCTTATTGGGTACTCGGTGTTCAGAGGAGCCAATAAGCAGAAGCATGTATTTAAAAAGGATCCC
AAGGCACCCATATGGGGTAGTCCTCCAAAAGTTATTGGGGGAAAGTTGCTTGCTTCTGGCTATTGGGGCATTGCACGGCACTGTAATTAC
CTCGGGGATTTGTTGCTGGCATCGTCTTTTAGTTTACCTTGTGGTATAAGCTCTGTGGTTCCATACTTTTACCCCATATATCTTCTCATT
CTACTCATATGGAGGGAGAGAAGGGACGAAGCTAGATGTGCAGAGAAGTACAAAGATGTGTGGGCTGAATACCGTAAACTTGTTCCTTAC
AXGGATCTTACCTTACGTTTACTAGCTCAATCGTTTGTCCACGTTGCTTGTGCATTAGAGTCAGAATTAGCCTCACTGTACCGCACTACC
CAAGCATGA
Edits in Original Sequence 
(5')XTCAATAATCTCTTCATTTCTCTCACTCCATCATGGACTTCGGTGTCTATGTTGATCGGATTTTTTCTCTATTTAGCTACCGTTGG
ATCTATTCTACCCGGAAAACTTGTTCCTGGGGCGACTTTATCTGATGGAACTCGACTCCATTATCGTTGCAATGGTTTATTATCACTTCT
GTTGTTGGTTTTGCTTCTTGGAGTTGGGTCGCAGATGAATCTTGTTTCACCTACTGCTATAGCAGATAGAGGACTTGAGCTTTTGTCCAC
AACACTTATCTTTAGTGTTCTTGTGACATTGATGCTTTATTTGGTTGGCCTGAACTCACGTGCAAAGAGTTCATCACTGAAACCTCATGT
CTCAGGAAATCTAATCCATGACTGGTGGTTTGGGATACAACTGAATCCTGAATTCATGGGCATTGATCTCAAATTTTTCTTTGTTAGAGC
TGGTATGATGGGATGGTTACTTATCAATCTTTCAGTTCTTGCAAAATGTGTTATAGAGGCTAAATTGAGCCAATCAATGATTCTCTACCA
GCTATTTTGTGGGCTCTACATCCTTGACTACTTCTTCTATGAAGAGTTCATGACCTCCACATGGGATATAATAGCAGAGAGGTTGGGCTA
CATGCTGGTTTTTGGTGATCTAGTCTTTATACCGTTCACCTTCAGTATTCAGGGTTGGTGGCTTTTGAGTAACAAAGTGGAGCTAACAAC
AGCAGCAATAATTGCCAATTGCCTCGTCTTTCTTATTGGGTACTCGGTGTTCAGAGGAGCCAATAAGCAGAAGCATGTATTTAAAAAGGA
TCCCAAGGCACCCATATGGGGTAGTCCTCCAAAAGTTATTGGGGGAAAGTTGCTTGCTTCTGGCTATTGGGGCATTGCACGGCACTGTAA
TTACCTCGGGGATTTGTTGCTGGCATCGTCTTTTAGTTTACCTTGTGGTATAAGCTCTGTGGTTCCATACTTTTACCCCATATATCTTCT
CATTCTACTCATATGGAGGGAGAGAAGGGACGAAGCTAGATGTGCAGAGAAGTACAAAGATGTGTGGGCTGAATACCGTAAACTTGTTCC
TTACAXGGATCTTACCTTACGTTTACTAGCTCAATCGTTTGTCCACGTTGCTTGTGCATTAGAGTCAGAATTAGCCTCACTGTACCGCAC
TACCCAAGCATGA(3')GAAGGGACGAACTCATGAATGAATATTACATCAAATTCGAGCTTTTGCCCTATCTATGCAGCTTTCTCATCTC
CTCTACGAAAGTAATCTTTTAATCTATTTCAGTTAGGATCAACACTGTATCCAGGTTGTAACTGATTGCTTAGCTTTTGAAAGTTTTTCC
AGAACCAACTTGTACACTAGATGTACTTTATCATGGCAGGATTTAAATGTGCTGCTTGTATTGAATGCCAACTATGGAATTATTTTTCAT
GGTTTGTAATCTTGGAGCAGCTTACTAATGTGTGCTGAAATTTTCGAATGATTTTCCCGACTTTCTAGTTTTTTGTATGCCCCTTGACTA
ATTTCAGGAGATATTTGCTACGTTCCCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan