Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U320935

Score 
1102
Direction 
Forward
Predicted Peptide Sequence 
KDLLSSFISSNSGNSTXKKGKDSYEEENYCKKIVADSDTLLGNSNWVWVFLGDGLNPSSRMDSQTAAEKAVSVIGLGYDLTSDIRLTACK
IGPNGYGLIEIDQKSTKDXAGAWWGGGFNVSTSIKCDKGERTRFRSDALSFSQMSEQLNQELSLSGKIPSGLFNAMFGHKGCWQKDASST
KLLAFDGWFITLYNIELVRSHLTLSEQVKQDVPSSWDPPALAEFIEKYGTHIVVGVKMGGKDVIHIKQLQNSVLQPMEVQKLLKQLADEK
FSEDINGCQIAKPVRSVEKSKGEKSIFSDPHLPFANSMRPSIMSYSKADDLLSIHIRRGGLDFGQSHSQWLPTVSQSPNAISMSFVPIAS
LLSGVRGSGFLSHAINLYLRYKPPIEELEQFLEFQLPRQWAPAYGDLPLGHRHRKQASPSLQFTLMGPKLYVNTVKVDSGNRPVTGIRLY
LEGKRSDHLAIHLQHLSALPQSIQLTDDLSYEPVDEPVERGYLEPVKWSIFSHVCTAPVEYRGTRIDDSASIVTKAWFEVKVIGMKKVLF
LRLGFSMVASAKIRRSEWEGPATXMSKIRFDLNADHYPIQYKAKPTPEANKGGLEFRGLPGGPPSPARAPKMSHFVDTTEMVRGPEESPG
YWVVTGAKLCVEDSRIRMKVKYSLLTILTEESLLI
Predicted Coding Sequence 
AAAGACCTGCTTTCTTCTTTCATCAGCTCTAATTCTGGAAATAGTACTXCAAAAAAGGGCAAAGACTCCTATGAAGAAGAGAATTACTGT
AAAAAAATAGTTGCAGATTCTGACACCCTTTTGGGAAATTCGAATTGGGTTTGGGTTTTCTTGGGAGATGGCTTAAATCCTAGTAGTAGA
ATGGACTCACAAACGGCTGCTGAAAAAGCCGTCTCTGTGATTGGGTTAGGTTATGATTTGACAAGTGATATCCGGTTGACGGCCTGTAAA
ATCGGACCGAATGGGTATGGTTTGATAGAGATTGATCAGAAGTCGACCAAGGACXCTGCTGGTGCCTGGTGGGGTGGTGGTTTCAATGTT
TCCACCTCTATCAAGTGCGATAAAGGGGAACGAACTAGGTTTCGCTCTGATGCTCTTTCTTTTAGTCAGATGTCAGAGCAATTAAATCAG
GAGCTGTCCCTGTCTGGTAAGATACCTTCTGGGTTGTTTAATGCGATGTTTGGTCACAAGGGATGCTGGCAAAAAGATGCATCTTCGACA
AAGCTTCTCGCTTTTGATGGTTGGTTCATTACCTTGTACAATATTGAGTTGGTGAGATCCCATCTAACACTGTCTGAGCAAGTAAAACAA
GACGTGCCTTCTTCTTGGGATCCTCCTGCACTTGCAGAGTTTATTGAAAAATATGGCACCCATATTGTTGTCGGGGTAAAGATGGGAGGT
AAAGATGTAATTCACATAAAGCAACTGCAAAATTCCGTTCTTCAGCCAATGGAGGTGCAGAAATTACTCAAGCAATTAGCTGATGAAAAA
TTTTCAGAAGACATAAATGGATGCCAGATAGCAAAACCTGTTAGATCTGTTGAAAAATCAAAGGGCGAAAAATCAATATTCTCAGATCCG
CATCTACCATTTGCAAACTCAATGAGACCATCTATTATGTCTTACTCCAAAGCTGATGATCTACTAAGTATTCATATCCGACGAGGAGGT
CTTGATTTTGGTCAAAGTCATAGCCAGTGGCTTCCTACTGTATCACAGTCCCCCAATGCTATATCAATGTCGTTTGTGCCAATCGCTTCA
CTTTTGAGTGGTGTAAGGGGCAGTGGATTTTTAAGCCATGCAATTAATCTTTACCTGCGATATAAACCACCAATCGAGGAACTTGAACAA
TTTTTAGAATTTCAGTTACCTCGGCAGTGGGCTCCAGCATATGGTGATCTTCCTCTTGGTCATCGCCACAGAAAACAGGCCTCTCCATCC
TTGCAGTTCACTTTGATGGGTCCAAAGCTATACGTTAACACTGTAAAGGTTGACTCTGGAAACAGGCCAGTAACTGGAATTCGGTTATAC
TTGGAAGGTAAAAGGAGTGATCACCTGGCTATCCATCTTCAACATCTATCAGCACTTCCTCAAAGTATCCAACTAACAGATGATCTTAGC
TATGAGCCTGTCGATGAACCAGTTGAACGAGGGTATCTTGAACCTGTCAAATGGAGCATATTTTCACATGTTTGCACCGCCCCAGTAGAA
TACCGTGGAACACGGATCGATGACTCTGCTTCTATTGTGACCAAGGCCTGGTTTGAGGTGAAGGTTATTGGAATGAAGAAGGTCCTCTTC
CTGAGGCTGGGATTCTCGATGGTCGCCTCAGCGAAGATCCGTCGGTCAGAGTGGGAAGGACCAGCAACCAXCATGTCGAAAATCAGGTTT
GATCTCAATGCTGATCACTACCCCATTCAGTACAAAGCTAAACCAACCCCAGAAGCCAACAAAGGTGGACTTGAATTCCGCGGTTTACCT
GGTGGTCCACCTTCACCAGCAAGAGCGCCAAAGATGTCGCACTTTGTTGATACAACAGAAATGGTAAGAGGTCCCGAGGAGTCCCCTGGT
TACTGGGTGGTTACTGGTGCAAAGCTGTGTGTAGAAGATAGTAGGATAAGAATGAAAGTGAAGTACTCCCTCTTAACCATACTTACAGAG
GAGTCATTGTTGATATAA
Edits in Original Sequence 
(5')AAAGACCTGCTTTCTTCTTTCATCAGCTCTAATTCTGGAAATAGTACTXCAAAAAAGGGCAAAGACTCCTATGAAGAAGAGAATTA
CTGTAAAAAAATAGTTGCAGATTCTGACACCCTTTTGGGAAATTCGAATTGGGTTTGGGTTTTCTTGGGAGATGGCgTTAAATCCTAGTA
GTAGAATGGACTCACAAACGGCTGCTGAAAAAGCCGTCTCTGTGATTGGGTTAGGTTATGATTTGACAAGTGATATCCGGTTGACGGCCT
GTAAAATCGGACCGAATGGGTATGGTTTGATAGAGATTGATCAGAAGTCGACCAAGGACXCTGCTGGTGCCTGGTGGGGTGGTGGTTTCt
AATGTTTCCACCTCTATCAAGTGCGATAAAGGGGAACGAACTAGGTTTCGCTCTGATGCTCTTTCTTTTAGTCAGATGTCAGAGCAATTA
AATCAGGAGCTGTCCCTGTCTGGTAAGATACCTTCTGGGTTGTTTAATGCGATGTTTGGTCACAAGGGATGCTGGCAAAAAGATGCATCT
TCGACAAAGCTTCTCGCTTTTGATGGTTGGTTCATTACCTTGTACAATATTGAGTTGGTGAGATCCCATCTAACACTGTCTGAGCAAGTA
AAACAAGACGTGCCTTCTTCTTGGGATCCTCCTGCACTTGCAGAGTTTATTGAAAAATATGGCACCCATATTGTTGTCGGGGTAAAGATG
GGAGGTAAAGATGTAATTCACATAAAGCAACTGCAAAATTCCGTTCTTCAGCCAATGGAGGTGCAGAAATTACTCAAGCAATTAGCTGAT
GAAAAATTTTCAGAAGACATAAATGGATGCCAGATAGCAAAACCTGTTAGATCTGTTGAAAAATCAAAGGGCGAAAAATCAATATTCTCA
GATCCGCATCTACCATTTGCAAACTCAATGAGACCATCTATTATGTCTTACTCCAAAGCTGATGATCTACTAAGTATTCATATCCGACGA
GGAGGTCTTGATTTTGGTCAAAGTCATAGCCAGTGGCTTCCTACTGTATCACAGTCCCCCAATGCTATATCAATGTCGTTTGTGCCAATC
GCTTCACTTTTGAGTGGTGTAAGGGGCAGTGGATTTTTAAGCCATGCAATTAATCTTTACCTGCGATATAAACCACCAATCGAGGAACTT
GAACAATTTTTAGAATTTCAGTTACCTCGGCAGTGGGCTCCAGCATATGGTGATCTTCCTCTTGGTCATCGCCACAGAAAACAGGCCTCT
CCATCCTTGCAGTTCACTTTGATGGGTCCAAAGCTATACGTTAACACTGTAAAGGTTGACTCTGGAAACAGGCCAGTAACTGGAATTCGG
TTATACTTGGAAGGTAAAAGGAGTGATCACCTGGCTATCCATCTTCAACATCTATCAGCACTTCCTCAAAGTATCCAACTAACAGATGAT
CTTAGCTATGAGCCTGTCGATGAACCAGTTGAACGAGGGTATCTTGAACCTGTCAAATGGAGCATATTTTCACATGTTTGCACCGCCCCA
GTAGAATACCGTGGAACACGGATCGATGACTCTGCTTCTATTGTGACCAAGGCCTGGTTTGAGGTGAAGGTTATTGGAATGAAGAAGGTC
CTCTTCCTGAGGCTGGGATTCTCGATGGTCGCCTCAGCGAAGATCCGTCGGTCAGAGTGGGAAGGACCAGCAACCAXCATGTCGAAAATC
AGGTTTGATCTCAATGCTGATCACTACCCCATTCAGTACAAAGCTAAACCAACCCCAGAAGCCAACAAAGGTGGACTTGAATTCCGCGGT
TTAtCCTGGTGGTCCACCTTCACCAGCAAGAGCGCCAAAGATGTCGCACTTTGTTGATACAACAGAAATGGTAAGAGGTCCCGAGGAGTC
CCCTGGTTACTGGGTGGTTACTGGTGCAAAGCTGTGTGTAGAAGATAGTAGGATAAGAATGAAAGTGAAGTACTCCCTCTTAACCATACT
TACAGAGGAGTCATTGTTGATATAA(3')ACGATTGAAAGATTTCATTTCAAGCTTTATCCATCTTTCTCTATAGGACATTGTGTATATT
TCATCTGATATTTGCGCAGATATGCAGAAAGTGTTATAGCAAGGTCAAATTGACCCAGTTAACAGTTGAGTGTGTAAAGAAATTATGAAA
CTTTTGTTGAAAGAAAACGAAGAGTTTCTGAATGTACATTTAACGTTCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
ATTTGGGGGGGGGGGGGGGGACCCATTTCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan