ESTScan Details for Unigene SGN-U320967

Score 
930
Direction 
Forward
Predicted Peptide Sequence 
KTLIPLAEKKEGVAXKMVFTISSNPVQFTHTTSLNARPNCYLKASVPVSNLSFSFFRHEYIRFSVKSRLNKRMVCAAASAAGSSSSSDDS
NPYEVLGVNPIEGFDMVKAAYARRRKDAERRGDEATLAQLEKAYDKIMMSQLTKRKQGVTFGSFKVSKEVRYADKQPILPWGPRFTKSDD
KDIKINLAISAVFIAWVFINRNAEWKPLQFLAFAFVYRIFEKLKAFEPPTPTFTEEGEDEGXDDEDGKKAASSLALVFGCIAIASLGYTG
LLNFIEYAGGFIPVFLYNNQELLVTGFTAIVLSIIASYYR
Predicted Coding Sequence 
XXGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGTTCAGTTTACA
CATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTTCAGACATGAA
TACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTCTAGCGATGAC
TCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAAAGATGCTGAG
CGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAAGCAGGGTGTC
ACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCACCAAATCTGAT
GACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAAGCCTTTACAG
TTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACAGAGGAAGGCGAAGAT
GAAGGACXGGATGATGAGGATGGGAAAAAGGCTGCTTCTTCTCTTGCATTAGTTTTTGGTTGCATAGCTATTGCATCTTTGGGATATACT
GGTCTCCTCAATTTTATCGAGTATGCTGGTGGTTTCATACCTGTCTTTCTGTACAATAATCAGGAATTGCTTGTAACTGGATTCACAGCC
ATCGTGCTTTCCATCATCGCATCTTATTACAGATAG
Edits in Original Sequence 
(5')XXGAAAACCCTAATCCCTTTAGCAGAGAAGAAAGAAGGAGTAGCTXCAAAAATGGTGTTTACAATATCATCAAACCCTGTTCAGTT
TACACATACTACTTCTTTAAATGCTCGACCCAATTGTTATCTCAAAGCTTCTGTTCCAGTTTCAAATTTATCGTTTTCTTTCTTCAGACA
TGAATACATCAGGTTTTCTGTAAAATCTCGCCTGAATAAAAGGATGGTCTGTGCTGCTGCTTCAGCTGCTGGAAGTTCTAGTTCTAGCGA
TGACTCAAATCCTTATGAGGTTCTGGGTGTAAACCCTATTGAGGGATTTGACATGGTTAAGGCAGCATATGCAAGGAGAAGGAAAGATGC
TGAGCGGAGGGGTGATGAAGCAACGCTTGCTCAGTTGGAGAAGGCTTATGACAAAATCATGATGTCACAGTTAACAAAAAGGAAGCAGGG
TGTCACTTTTGGCTCGTTTAAGGTATCTAAAGAGGTACGATATGCTGATAAGCAGCCTATTTTGCCATGGGGTCCACGGTTCACCAAATC
TGATGACAAAGATATCAAAATCAACTTGGCAATTTCAGCTGTATTTATAGCTTGGGTTTTTATAAATCGTAATGCTGAGTGGAAGCCTTT
ACAGTTTTTGGCCTTCGCCTTTGTATATAGGATATTTGAGAAATTAAAAGCATTTGAGCCTCCAACTCCCACGTTTACAGAGGAAGGCGA
AGATGAAGGACXGGATGATGAGGATGGGAAAAAGGCTGCTTCgTTCTCTTGCATTAGTTTTTGGTTGCATAGCTATTGCATCTTTGGGAT
ATACTGGTCTCCTCAATTTTATCGAGTATGCTGGTGGTTTCATACCTGTCTTTCTGTACAATAATCAGGAATTGCTTGTAACTGGATTCA
CAGCCATCGTGCTTTCCATCATCGCATCTTATTACAGATAG(3')TCTACCTTCTACACTTGTTGAAGAAGAGATGCAGTTGCCTTGTGT
TAGCTGTCAAATTTTGTAATTCTATTTGTTCCAGAAATTTGCCTTGTTTTGTCTATAGGATTTGATTGAGCAGCAGTTGTAAGGATGCAC
CAAGTTCTGAGGATTCTAGGATTAAACAAGACCACAATCTTTTCAAAATTGATGGATGTTAATGTGGAAATATAAATGATAATCAGGAGG
AAAGGTTAGGGCGGATCAATCCTTCATTTGAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan