ESTScan Details for Unigene SGN-U321159

Score 
986
Direction 
Forward
Predicted Peptide Sequence 
LLPFLSGHPDSSSVRIKFGVPIQRLNDWPXDSASATPIYNNGYSIFSHFILLQLQALASPAGFYIASESXMEQQEDSMSEMKQLQGANAM
ATVIVLIFLAILSAPSQRRAQSVGFKTKVKVKYETLWAHNLYVMVMAVETIGGVKAHSLAVLTDAAHLLSDVVGFSISLFAVWVSGWDAT
KEHSFGYHRLEVLGALISVQLIWLISGFLIYEATERMFHTNAKVNGKLMFAIAAFGLIINFISVVWLGHDHSLHSHSFSPCKDHDHGHGH
DHNHDHEMQELHPRNEEESSKLVASCHSCSKPSNINIEGAYLHVISDLIQSVGVMIAGAIMWYKPEWLVVDLLCTIFFSIFALSTTVPML
KTIFSLLMERTPKEVDIVQLENGLKSLAGVKDVHDLHVWAITIGKIVLSCHVVTEPGVNHYEIIQNVREYCDTTYRIHHVTIQVEPGSL
Predicted Coding Sequence 
CTCTTACCTTTCCTTTCCGGCCACCCTGATTCTTCTTCCGTCAGAATCAAATTTGGTGTGCCCATTCAGCGCCTTAATGATTGGCCTXCT
GACTCCGCCTCTGCAACTCCTATATACAACAATGGTTATTCAATTTTTTCTCATTTTATTCTTTTACAGCTACAAGCCCTAGCTTCCCCT
GCCGGCTTTTATATTGCATCTGAATCCAXGATGGAGCAACAAGAGGATTCCATGTCTGAAATGAAGCAGTTGCAGGGAGCAAATGCAATG
GCAACTGTAATCGTGCTCATTTTTCTTGCAATCCTATCTGCTCCTTCTCAGAGAAGAGCACAGTCTGTTGGATTCAAGACAAAGGTCAAA
GTCAAGTATGAAACTTTGTGGGCTCATAATCTTTATGTTATGGTCATGGCAGTGGAAACCATTGGAGGGGTGAAAGCCCACAGTCTTGCG
GTTCTAACTGATGCAGCTCACTTGCTTAGTGATGTTGTTGGATTTTCTATTTCGCTTTTTGCTGTTTGGGTGTCTGGCTGGGATGCAACC
AAAGAACACTCTTTTGGATATCACCGACTTGAAGTTTTAGGAGCCCTTATTTCTGTACAGCTGATATGGCTCATCTCTGGTTTTTTGATT
TATGAAGCAACTGAGAGAATGTTTCATACTAACGCCAAAGTGAATGGGAAGCTTATGTTTGCTATTGCTGCATTTGGTCTCATAATAAAC
TTCATTTCAGTTGTGTGGCTTGGACATGATCATTCTCTCCATAGCCATTCATTTAGTCCTTGCAAGGATCATGACCATGGTCACGGTCAT
GATCACAATCATGATCATGAAATGCAAGAATTGCATCCAAGAAATGAAGAAGAGAGCTCGAAACTGGTAGCATCATGCCATAGTTGCAGC
AAACCATCAAACATAAATATTGAAGGGGCTTACCTGCATGTTATATCTGATTTGATACAATCTGTTGGTGTGATGATTGCTGGAGCTATT
ATGTGGTACAAACCAGAATGGTTGGTGGTTGATCTTCTCTGTACTATTTTTTTCTCAATCTTTGCTCTTAGTACTACTGTACCCATGCTT
AAGACTATATTTTCCTTATTGATGGAGAGGACACCAAAGGAAGTTGATATCGTTCAACTCGAGAATGGCCTAAAATCTTTAGCAGGAGTA
AAAGATGTTCATGACCTACATGTTTGGGCCATCACTATAGGGAAAATTGTTTTGTCCTGTCACGTTGTAACTGAGCCAGGAGTCAACCAT
TATGAAATTATTCAGAATGTTAGGGAATATTGTGACACCACATACAGAATTCATCATGTAACCATACAAGTTGAACCAGGTTCATTGTAG
Edits in Original Sequence 
(5')CTCTTACCTTTCCTTTCCGGCCACCCTGATTCTTCTTCCGTCAGAATCAAATTTGGTGTGCCCATTCAGCGCCTTAATGATTGGCC
TXCTGACTCCGCCTCTGCAACTCCTATATACAACAATGGTTATTCAATTTTTTCTCATTTTATTCTTTTACAGCTACAAGCCCTAGCTTC
CCCTGCCGGCTTTTATATTGCATCTGAATCCAXGATGGAGCAACAAGAGGATTCCATGTCTGAAATGAAGCAGTTGCAGGGAGCtAAATG
CAATGGCAACTGTAATCGTGCTCATTTTTCTTGCAATCCTATCTGCTCCTTCTCAGAGcAAGAGCACAGTCTGTTGGATTCAAGACAAAG
GTCAAAGTCAAGTATGAAACTTTGTGGGCTCATAATCtTTTATGTTATGGTCATGGCAGTGGAAACCATTGGAGGGGTGAAAGCCCACAG
TCTTGCGGTTCTAACTGATGCAGCTCACTTGCTTAGTGATGTTGTTGGATTTTCTATTTCGCTTTTTGCTGTTTGGGTGTCTGGCTGGGA
TGCAACCAAAGAACACTCTTTTGGATATCACCGACTTGAAGTTTTAGGAGCCCTTATTTCTGTACAGCTGATATGGCTCATCTCTGGTTT
TTTGATTTATGAAGCAACTGAGAGAATGTTTCATACTAACGCCAAAGTGAATGGGAAGCTTATGTTTGCTATTGCTGCATTTGGTCTCAT
AATAAACTTCATTTCAGTTGTGTGGCTTGGACATGATCATTCTCTCCATAGCCATTCATTTAGTCCTTGCAAGGATCATGACCATGGTCA
CGGTCATGATCACAATCATGATCATGAAATGCAAGAATTGCATCCAAGAAATGAAGAAGAGAGCTCGAAACTGGTAGCATCATGCCATAG
TTGCAGCAAACCATCAAACATAAATATTGAAGGGGCTTACCTGCATGTTATATCTGATTTGATACAATCTGTTGGTGTGATGATTGCTGG
AGCTATTATGTGGTACAAACCAGAATGGTTGGTGGTTGATCTTCTCTGTACTATTTTTTTCTCAATCTTTGCTCTTAGTACTACTGTACC
CATGCTTAAGACTATATTTTCCTTATTGATGGAGAGGACACCAAAGGAAGTTGATATCGTTCAACTCGAGAATGGCCTAAAATCTTTAGC
AGGAGTAAAAGATGTTCATGACCTACATGTTTGGGCCATCACTATAGGGAAAATTGTTTTGTCCTGTCACGTTGTAACTGAGCCAGGAGT
CAACCATTATGAAATTATTCAGAATGTTAGGGAATATTGTGACACCACATACAGAATTCATCATGTAACCATACAAGTTGAACCAGGTTC
ATTGTAG(3')ATTGTATATATTGCTTGCTTCATCTCTCTTTCTCTATATCTCTCTCTTGTTGAGTATAGCTTAGATGTGAATGTACTTC
ATATTTATAGTCTTTGTTTTCTTGGTAGCATAATTATTTTAGTTAACCCTTAGCTAGAGTGATGACTGCCAACATAATTTGAGAAATTAG
ATGTTCTTTTACCCCAGATTTTTGCTGTGCTTTTGAGTTTTTTAAGGTCCAAGACATGAAAGTTGTAAATTTTTCTCATATTATTTCCAT
TATAAGGATGCACTAATCATCAACTGGAGTTCCCAAGTTGTGCCTTTTGCAATTTTGAGAAGCCACACCTTTTAACCAAGTTGTCAGCCG
TCCACTATGTGACTTGGTCAACTTCTCCCACATACGGGGGTATTTTTGTTCCTTTGCAACTTGCTAATCAAAGCGACTAAATAGATGTAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan