ESTScan Details for Unigene SGN-U321266

Score 
1257
Direction 
Forward
Predicted Peptide Sequence 
MASTASLSLRPSSLISAVPILPVFLLPPPLVSSPVGPACGAHTKFISISFSSSQKIPGRRFGRLVVAAAADYYSTLGVPKSANSKDIKAA
YRRLARQYHPDVNKEPNAPEKFKEIKDAYEILSDDKKRALYDQYGEAGVKSSVGAQAGAYTTNPFDLFETFFGPSMGGFGMDGAGFGTRR
RSTVTKGEDLRYDMTLEFSAAIFGAEKDFELSHLETCEVCVGTGAKVGSKMRICSTCGGRGQVMRTEQTPFGMFSQVSVCPNCGGDGEMI
SEYCRKCSGEGRIRVKKDIKVKIPPGVNKGSILRVAGEGDAGPRGAPPGDLYVYLDIEEIPEIQRDGINLISTVSVGYLDAILGAVVKVK
TVDGLTDLQIPPGTQPGDVLVLARKGAPKLNKPSNAVITCSXIKVSIPKRISVMERELLEELASLTKGSSTRTKTRPAVQQTAKVTETPV
GSDSSAAKTDESSSEDRDDPLKKLANFAGSVVNGAXEMVKRQPVVLGAGILPQQSSFIRQWH
Predicted Coding Sequence 
ATGGCCAGCACAGCATCTCTATCTCTCCGTCCTTCTTCTCTCATCTCCGCCGTTCCCATTCTCCCTGTCTTCCTCCTTCCTCCTCCTCTA
GTTTCTTCTCCGGTGGGACCCGCTTGTGGXGCCCATACGAAGTTTATATCCATTTCCTTTTCTTCATCTCAGAAGATTCCGGGACGACGT
TTTGGGAGATTGGTGGTTGCTGCTGCTGCCGATTATTACTCTACACTTGGGGTCCCAAAATCTGCTAACAGTAAAGACATCAAGGCTGCT
TATCGAAGGTTAGCTCGACAGTATCACCCTGATGTCAACAAGGAACCTAATGCACCAGAAAAGTTTAAGGAGATTAAAGATGCTTATGAG
ATACTATCAGATGACAAAAAAAGAGCACTATATGATCAATATGGTGAAGCCGGGGTGAAAAGTTCTGTAGGGGCCCAAGCCGGTGCTTAC
ACGACAAATCCTTTTGATCTATTTGAGACATTCTTTGGACCTTCTATGGGTGGTTTTGGAATGGATGGAGCTGGATTTGGAACGCGTCGC
CGCAGTACTGTTACCAAGGGTGAAGATCTACGTTACGACATGACATTAGAATTTTCAGCGGCTATCTTTGGAGCTGAAAAAGATTTCGAG
CTTTCACATCTTGAAACTTGTGAGGTCTGTGTGGGAACTGGGGCAAAGGTAGGCTCCAAAATGAGGATATGTTCAACTTGTGGTGGCCGA
GGTCAAGTTATGAGGACCGAACAAACACCGTTTGGCATGTTTTCTCAGGTTTCTGTCTGCCCAAACTGTGGTGGGGATGGTGAAATGATC
TCTGAATATTGTCGTAAATGCTCAGGCGAGGGGCGGATACGAGTGAAGAAAGATATAAAAGTCAAGATACCCCCTGGAGTTAACAAGGGA
AGTATCCTCAGAGTTGCTGGTGAGGGTGATGCAGGTCCTAGGGGTGCCCCACCGGGAGATCTTTATGTCTATCTTGACATTGAAGAGATA
CCTGAGATCCAAAGAGATGGCATAAATCTGATTTCAACAGTTTCAGTCGGTTATCTAGATGCTATACTTGGGGCTGTTGTTAAGGTTAAA
ACAGTGGATGGTTTGACTGATCTCCAGATTCCTCCAGGCACTCAACCTGGGGATGTGCTTGTCTTGGCAAGGAAAGGAGCACCAAAGCTA
AATAAGCCATCAAACGCGGTGATCACTTGTTCACXGATTAAAGTTAGCATACCAAAACGCATCAGTGTGATGGAGCGTGAATTGCTTGAA
GAACTTGCTTCTCTTACTAAGGGATCAAGCACTCGTACAAAAACTCGCCCGGCGGTTCAGCAAACGGCAAAAGTTACTGAAACTCCAGTA
GGTTCAGATTCAAGTGCAGCAAAAACTGATGAGTCATCATCAGAAGATCGAGACGATCCATTGAAGAAGTTAGCAAATTTTGCTGGGTCT
GTCGTAAATGGTGCAXCTGAAATGGTTAAGAGACAACCTGTAGTACTTGGTGCTGGGATACTGCCTCAGCAATCTTCTTTTATACGACAA
TGGCATTGA
Edits in Original Sequence 
TTCTTTCTTGTGAAAAAAAAGAAGCAAGCGAGCATCAAGGCGCGGGACAGTTAACCAGTCTTCTGTAGTCCAATGAACTCGACGGCA(5')
ATGGCCAGCACAGCATCTCTATCTCTCCGTCCTTCTTCTCTCATCTCCGaCCGTTCCCATTCTCCCTGTCTTCCTCCTTCCTCCTCCTC
TAGTTTCTTCTCCGGTGGGACCCGCTTGTGGXGCCCATACGAAGTTTATATCCATTTCCTTTTCTTCATCTCAGAAGATTCCGGGACGAC
GTTTTGGGAGATTGGTGGTTGCTGCTGCTGCCGATTATTACTCTACACTTGGGGTCCCAAAATCTGCTAACAGTAAAGACATCAAGGCTG
CTTATCGAAGGTTAGCTCGACAGTATCACCCTGATGTCAACAAGGAACCTAATGCACCAGAAAAGTTTAAGGAGATTAAAGATGCTTATG
AGATACTATCAGATGACAAAAAAAGAGCACTATATGATCAATATGGTGAAGCCGGGGTGAAAAGTTCTGTAGGGGCCCAAGCCGGTGCTT
ACACGACAAATCCTTTTGATCTATTTGAGACATTCTTTGGACCTTCTATGGGTGGTTTTGGAATGGATGGAGCTGGATTTGGAACGCGTC
GCCGCAGTACTGTTACCAAGGGTGAAGATCTACGTTACGACATGACATTAGAATTTTCAGCGGCTATCTTTGGAGCTGAAAAAGATTTCG
AGCTTTCACATCTTGAAACTTGTGAGGTCTGTGTGGGAACTGGGGCAAAGGTAGGCTCCAAAATGAGGATATGTTCAACTTGTGGTGGCC
GAGGTCAAGTTATGAGGACCGAACAAACACCGTTTGGCATGTTTTCTCAGGTTTCTGTCTGCCCAAACTGTGGTGGGGATGGTGAAATGA
TCTCTGAATATTGTCGTAAATGCTCAGGCGAGGGGCGGATACGAGTGAAGAAAGATATAAAAGTCAAGATACCCCCTGGAGTTAACAAGG
GAAGTATCCTCAGAGTTGCTGGTGAGGGTGATGCAGGTCCTAGGGGTGCCCCACCGGGAGATCTTTATGTCTATCTTGACATTGAAGAGA
TACCTGAGATCCAAAGAGATGGCATAAATCTGATTTCAACAGTTTCAGTCGGTTATCTAGATGCTATACTTGGGGCTGTTGTTAAGGTTA
AAACAGTGGATGGTTTGACTGATCTCCAGATTCCTCCAGGCACTCAACCTGGGGATGTGCTTGTCTTGGCAAGGAAAGGAGCACCAAAGC
TAAATAAGCCATCAAtACGCGGTGATCACTTGTTCACXGATTAAAGTTAGCATACCAAAACGCATCAGTGTGATGGAGCGTGAATTGCTT
GAAGAACTTGCTTCTCTTACTAAGGGATCAAGCACTCGTACAAAAACTCGCCCGGCGGTTCAGCAAACGGCAAAAGTTACTGAAACTCCA
GTAGGTTCAGATTCAAGTGCAGCAAAAACTGATGAGTCATCATCAGAAGATCGAGACGATCCATTGAAGAAGTTAGCAAATTTTGCTGGG
TCTGTCGTAAATGGTGCAXCTGAAATGGTTAAGAGACAACCTGTAGTACTTGGTGCTGGGATACTGCCTCAGCAATCTTCTTTTATACGA
CAATGGCATTGA(3')ATTTTATGTGCTTCAAAACAGCCATTATTGCATCTTGCGGCCTTTCATTTCTTAGAATAACTTTTTGGTGATTC
TGCCTGTAAAATTGAATCCAGCCACCTTATTCTTTTAGGAAACCTAATCCTTCGCCTTTGTAAATTCTGACAAATATATTCTCCACCTCA
AAGAAGTTGGTGAGATGGATTCTAACAGCTATTTTTGTATAAGAAATTTTGTATGTCAGCAAGCATTTAACAGAAACCCAGAAATATCCC
AAAAAAAAAAAANNAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan