ESTScan Details for Unigene SGN-U321494

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
IATPPSEMDNEVGRADPEASAAPMDTDAGIATVNICQEETPTPEDNQKQSSDTDVAQEAGQIEADTEAETGMIDGETDAEDLDQQDNPSV
YWIVHHAGVTCVNNPLNLGSICTM
Predicted Coding Sequence 
ATTGCAACACCACCAAGTGAGATGGACAATGAAGTGGGCAGAGCGGATCCTGAAGCATCTGCTGCTCCCATGGATACAGATGCAGGAATA
GCTACTGTTAACATATGTCAGGAAGAAACTCCTACTCCGGAGGATAACCAGAAGCAAAGCTCTGACACAGATGTTGCTCAAGAAGCAGGG
CAGATTGAAGCAGACACAGAAGCAGAGACGGGGATGATTGATGGAGAAACAGATGCAGAAGATCTAGATCAGCAGGATAATCCAAGTGTG
TATTGGATTGTGCACCATGCCGGTGTAACTTGTGTCAACAATCCACTTAATCTGGGCTCAATTTGTACCATGTAA
Edits in Original Sequence 
(5')ATTGCAACACCACCAAGTGAGATGGACAATGAAGTGGGCAGAGCGGATCCTGAAGCATCTGCTGCTCCCATGGATACAGATGCAGG
AATAGCTACTGTTAACATATGTCAGGAAGAAACTCCTACTCCGGAGGATAACCAGAAGCAAAGCTCTGACACAGATGTTGCTCAAGAAGC
AGGGCAGATTGAAGCAGACACAGAAGCAGAGACGGGGATGATTGATGGAGAAACAGATGCAGAAGATCTAGATaCAGCAGGATAATCCAA
GTGTGTATTGGATTGTGCACCATGCCGGTGTAACTTGTGTCAACAATCCACTTAATCTGGGCTCAATTTGTACCATGTAA(3')CTTAAG
TCAGTTGCTTAAGAAGCTTGACAGCAAAAAAAAAAATAAATTAAAAATTACACAATTTAGAATTAATTACACATTTTTGCATAGATCTTA
ATTGTTGAGAGGTGGGATTTGTTGCAAGTGAGATTGAAGGATGGGTGTTGTGTATTAAATTATTAATAATACCTCTTTTTATGTTGTTTG
GTTGATTACGCAAGTTCTATTTCTTGTTGATACTCTATTATGTAATAATTGTCTTAGATTAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan