ESTScan Details for Unigene SGN-U321670

Score 
519
Direction 
Forward
Predicted Peptide Sequence 
MGVGGTLEYISEMMSIEKPKKKKKQFNTVELKVRMDCEGCEMKVKNTLSSMSGVKSVEINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEI
WPYIPYNLVSQPYAAQAYDKKAPPGYVRRVDQYPTTGTVARYEDPSYVNMFSDDNPNAVPSCNLLRYEKATERWHEKTQVLEPEMGLSEI
ASDFTNKITLNMLVIIW
Predicted Coding Sequence 
ATGGGTGTTGGAGGAACATTAGAGTATATCTCAGAAATGATGAGTATTGAAAAGCCAAAGAAGAAGAAGAAGCAGTTTAATACAGTGGAA
CTTAAAGTTAGAATGGATTGTGAGGGCTGTGAAATGAAAGTCAAAAATACATTATCTTCCATGAGTGGAGTGAAATCAGTGGAGATAAAC
AGGAAACAACAGAAGGTGACAGTAACAGGCTATGTGGAACCAAACAAAGTGTTAAAGAAGGCAAAGTCAACTGGAAAGAAGGCAGAGATA
TGGCCTTATATCCCATACAATTTGGTATCCCAGCCATATGCTGCTCAAGCTTATGATAAAAAGGCGCCTCCTGGCTACGTCAGGAGGGTC
GATCAGTACCCAACCACGGGTACTGTTGCGAGATATGAGGATCCTTCCTATGTCAACATGTTTAGTGATGACAATCCTAATGCTGTTCCA
TCATGTAACTTATTAAGGTACGAGAAAGCTACTGAAAGATGGCACGAGAAAACACAAGTTCTTGAGCCXGAAATGGGTCTATCAGAAATA
GCTTCGGATTTCACTAATAAAATCACGCTGAATATGTTGGTTATTATATGG
Edits in Original Sequence 
TAGCCCTTTTACTTTTGTTCTTAATTAATTAAGCTAATTTGTGTGTTAAACAAGAATCCAAAGGGAAGTTTCTTACAAACTCCCCACATT
TCAGTTAGCTAGCTACTATAAATTAACTCATAATTACACCATTTTCTTAATTAATTCCTCTAAATTAAAGAATA
(5')ATGGGTGTTGGA
GGAACATTAGAGTATATCTCAGAAATGATGAGTATTGAAAAGCCAAAGAAGAAGAAGAAGCAGTTTAATACAGTGGAACTTAAAGTTAGA
ATGGATTGTGAGGGCTGTGAAATGAAAGTCAAAAATACATTATCTTCCATGAGTGGAGTGAAATCAGTGGAGATAAACAGGAAACAACAG
AAGGTGACAGTAACAGGCTATGTGGAACCAAACAAAGTGTTAAAGAAGGCAAAGTCAACTGGAAAGAAGGCAGAGATATGGCCTTATATC
CCATACAATTTGGTATCCCAGCCATATGCTGCTCAAGCTTATGATAAAAAGGCGCCTCCTGGCTACGTCAGGAGGGTCGATCAGTACCCA
ACCACGGGTACTGTTGCGAGATATGAGGATCCTTCCTATGTCAACATGTTTAGTGATGACAATCCTAATGCtTGTTCCATCATGTAACTT
ATTAAGGTACGAGAAAGCTACTGAAAGATGGCACGAGAAAACACAAGTTCTTGAGCCXGAAATGGGTCTATCAGAAATAGCTTCGGATTT
CACTAATAAAATCACGCTGAATATGTTGGTTATTATATGG(3')GGGTGAAAAGTTAATTGTTGTATTGTAAGTTTTGCATGGGTTTTTT
TTAGAGTCATTAAGCAGTCTCAGGAATTTTGTGTAGTAAAACTACTAGTACTTGTAGTTATTGAATAATAATATACTTGAGTGTTCTTCT
TTTTTTAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan