ESTScan Details for Unigene SGN-U321701

Score 
696
Direction 
Forward
Predicted Peptide Sequence 
MAIXIEFAXDDVEKKQLGALIRTVNKSKLNISYETLEKAANYFNNSNKLGQGGSGSVYKGILPDGQVVAIKRLFFNTRQWVDHFFNEVNL
ISGIHHKNLVKLLGCSITGPESLLVYEYVPNHSLADYVFDTKNLQPLTWSQRYKIVLGTAEGLAYLHEESKLRIIHRDIKLSNVLLDEDF
TAKIADFGLARLFPEDRSHISTAIAGTLGYMAPEYVVRGILTEKADVYSFGVLVVEVVCGKKNNYVFKNTNSLLQQLWNLYGMGKSNEAV
DPLLEGNFNKEEASKLLQVGLVCVQASAELRPSMSSVVKMLSENHEIPQPTQPPFLNSGSSEFSPFNLHGKRFFGQPSSSTQSSGNKLTE
SWIEPR
Predicted Coding Sequence 
ATGGCAATTTGAATTGAATTTGCTGXTGATGATGTAGAGAAGAAGCAGCTAGGAGCTCTCATTAGAACGGTTAATAAATCAAAACTGAAT
ATTTCCTATGAAACTCTTGAGAAGGCAGCAAATTACTTTAACAACTCGAATAAATTGGGACAAGGAGGTTCTGGTTCTGTTTACAAGGGG
ATCTTGCCAGATGGGCAGGTTGTTGCTATAAAGAGGCTCTTCTTCAATACGAGGCAGTGGGTTGATCATTTCTTTAATGAGGTCAATTTG
ATTAGCGGCATTCATCACAAAAACTTGGTAAAGCTATTGGGTTGCAGCATTACAGGGCCGGAAAGTCTTCTAGTGTATGAGTATGTGCCC
AATCATAGTCTTGCGGATTACGTCTTTGACACAAAGAACCTTCAGCCACTTACATGGAGTCAAAGATACAAAATTGTATTGGGTACTGCT
GAGGGATTGGCCTATCTTCATGAAGAATCGAAATTAAGGATCATCCACCGAGACATAAAGTTGAGCAATGTTCTTCTAGATGAAGATTTC
ACGGCAAAAATAGCTGATTTTGGTCTAGCCAGGTTATTTCCTGAAGACAGGAGCCATATTAGCACAGCTATTGCTGGCACTCTCGGTTAC
ATGGCTCCAGAGTACGTTGTACGTGGCATACTGACTGAAAAAGCTGATGTCTATAGTTTTGGCGTTCTTGTTGTTGAAGTCGTGTGTGGA
AAGAAGAACAATTACGTTTTCAAGAACACTAACTCTCTTCTGCAACAGTTGTGGAACTTGTATGGGATGGGAAAATCTAATGAAGCAGTT
GACCCTTTATTAGAAGGTAACTTCAATAAAGAGGAGGCATCTAAACTGCTTCAAGTAGGTCTTGTTTGTGTACAAGCATCAGCAGAACTA
CGACCCTCTATGTCAAGTGTCGTGAAAATGCTCAGCGAGAACCATGAAATTCCTCAGCCAACACAGCCACCATTCCTCAATTCTGGTAGT
TCAGAATTTAGTCCATTTAATCTGCATGGGAAAAGATTTTTCGGCCAACCAAGCTCCTCGACACAATCTTCTGGGAATAAATTGACGGAG
AGTTGGATAGAGCCTAGATAA
Edits in Original Sequence 
TTGCTATTTGTATCGGCTGTTTCATTCTTTGTGCGGAGGAAGATTCTGAAACAAAAGAGAGGTACTAATTTCTAAGTCAAATCATTTTCA
TTCTTTCTGAAACAAGAAATCTCATTTAAGTCTGATTGATCAA
(5')ATGGCAATTTGAATTGAATTTGCTGXTGATGATGTAGAGAAGA
AGCAGCTAGGAGCTCTCATTAGAACGGTTAATAAATCAAAACTGAATATTTCCTATGAAACTCTTGAGAAGGCAGCAAATTACTTTAACA
ACTCGAATAAATTGGGACAAGGAGGTTCTGGTTCTGTTTACAAGGGGATCTTGCCAGATGGGCAGGTTGTTGCTATAAAGAGGCTCTTCT
TCAATACGAGGCAGTGGGTTGATCATTTCTTTAATGAGGTCAATTTGATTAGCGGCATTCATCACAAAAACTTGGTAAAGCTATTGGGTT
GCAGCATTACAGGGCCGGAAAGTCTTCTAGTGTATGAGTATGTGCCCAATCATAGTCTTGCGGATTACGTCTTTGACACAAAGAACCTTC
AGCCACTTACATGGAGTCAAAGATACAAAATTGTATTGGGTACTGCTGAGGGATTGGCCTATCTTCATGAAGAATCGAAATTAAGGATCA
TCCACCGAGACATAAAGTTGAGCAATGTTCTTCTAGATGAAGATTTCACGGCAAAAATAGCTGATTTTGGTCTAGCCAGGTTATTTCCTG
AAGACAGGAGCCATATTAGCACAGCTATTGCTGGCACTCTCGGTTACATGGCTCCAGAGTACGTTGTACGTGGCATACTGACTGAAAAAG
CTGATGTCTATAGTTTTGGCGTTCTTGTTGTTGAAGTCGTGTGTGGAAAGAAGAACAATTACGTTTTCAAGAACACTAACTCTCTTCTGC
AACAGTTGTGGAACTTGTATGGGATGGGAAAATCTAATGAAGCAGTTGACCCTTTATTAGAAGGTAACTTCAATAAAGAGGAGGCATCTA
AACTGCTTCAAGTAGGTCTTGTTTGTGTACAAGCATCAGCAGAACTACGACCCTCTATGTCAAGTGTCGTGAAAATGCTCAGCGAGAACC
ATGAAATTCCTCAGCCAACACAGCCACCATTCCTCAATTCTGGTAGTTCAGAATTTAGTCCATTTAATCTGCATGGGAAAAGATTTTTCG
GCCAACCAAGCTCCTCGACACAATCTTCTGGGAATAAATTGACGGAGAGTTGGATAGAGCCTAGATAA(3')ACTAAAAGTTGATCATCT
GGAATTGGTATTTGATTTTGTTCAAGTTTTTTTCTGTGATTAACTACTACTCACTACTCACTCTCCTCCACTTTCATTTTTTCTTTTTTA
CTGATATAGTCAACTTCCTTTTGTGAATATCCCAGTCATAATCTATTTCATTTCTCTAATGTAAAAAACTCTGCAGCAGTTGCAATTAAT
TAACTATATCTACTGTTTTCCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan