ESTScan Details for Unigene SGN-U321862

Score 
317
Direction 
Forward
Predicted Peptide Sequence 
SPEIYFLHNFTSSDSHNKPSNPSDHNRGHNRYVHFLNSLLPSKRLFVIPHSVSFCRSFSTVDLRIGNISDDSVVTQNENTDLLISENISA
NVEESILPVRALISLLDGYHDLTGFPWWIIIVSSAVAFRLTVIPVCIIATPQVEENWRVFPKLPPPLPPPMSGRSLRDQLKIFFKEKEQQ
AVLHFFGTSLSDSSGALLSSLDYDYXKNVTAHHEGFDCGGILWFQNLTEVPSGVLGPVFPLLIAGLHYINVQVSFRKSSVEKMSGFVGLI
AK
Predicted Coding Sequence 
XXTTCGCCGGAAATATACTTTCTCCACAATTTCACTTCTTCAGATTCTCACAATAAACCCTCAAACCCTTCCGATCACAACCGTGGGCAC
AACCGGTATGTCCATTTTTTGAACTCGTTGTTACCATCAAAGCGGCTATTTGTTATTCCGCACAGTGTTTCCTTCTGCCGTTCCTTCTCC
ACTGTCGACTTGCGAATTGGTAACATCAGTGACGACTCAGTGGTTACTCAGAATGAGAACACCGATTTGTTGATCAGCGAAAATATTAGT
GCAAATGTTGAGGAGTCCATTCTTCCAGTACGTGCCTTGATTTCGTTGCTGGATGGTTATCATGACCTCACTGGCTTCCCATGGTGGATC
ATTATAGTTTCTTCAGCAGTGGCTTTCAGGCTTACXGTTATTCCCGTTTGTATTATTGCAACTCCACAAGTTGAAGAGAATTGGAGAGTT
TTTCCTAAATTGCCTCCTCCACTGCCTCCGCCTATGTCAGGAAGGAGTCTTAGAGACCAACTTAAAATCTTTTTCAAGGAGAAAGAGCAG
CAGGCTGTCCTTCATTTTTTTGGTACTTCCCTCTCTGACAGTTCAGGTGCCCTGCTTTCTTCTTTGGATTACGACTATNAGAAGAATGTC
ACTGCTCATCATGAAGGCTTTGATTGTGGGGGCATTCTTTGGTTTCAGAACTTGACTGAGGTCCCTAGTGGTGTTTTAGGGCCAGTCTTT
CCATTACTGATTGCTGGATTGCATTATATTAACGTTCAGGTATCTTTTCGGAAATCTTCAGTTGAAAAAATGAGTGGATTCGTGGGATTA
ATAGCCAAG
Edits in Original Sequence 
(5')XXTTCGCCGGAAATATACTTTCTCCACAATTTCACTTCTTCAGATTCTCACAATAAACCCTCAAACCCTTCCGATCACAACCGTGG
GCACAACCGGTATGTCCATTTTTTGAACTCGTTGTTACCATCAAAGCGGCTATTTGTTATTCCGCACAGTGTTTCCTTCTGCCGTTCCTT
CTCCACTGTCGACTTGCGAATTGGTAACATCAGTGACGACTCAGTGGTTACTCAGAATGAGAACACCGATTTGTTGATCAGCGAAAATAT
TAGTGCAAATGTTGAGGAGTCCATTCTTCCAGTACGTGCCTTGATTTCGTTGCTGGATGGTTATCATGACCTCACTGGCTTCCCATGGTG
GATCATTATAGTTTCTTCAGCAGTGGCTTTCAGGCTTACXGTTATTCCCGTTTGTATTATTGCAACTCCACAAGTTGAAGAGAATTGGAG
AGTTaTTTCCTAAATTGCCTCCTCCACTGCCTCCGCCTATGTCAGGAAGGAGTCTTAGAGACCAACTTAAAATCTTTTTCAAGGAGAAAc
GAGCAGCAGGCTGTCCTTCATTTTTTTGGTACTTCgCCTCTCTGACAGTTCAGGTGCCCTGCTTTCTTCTTTGGATTACGACTATNAGAA
GAATGTCACTGCaTCATCATGAAGGCTTTGATTGTGGGGGCATTCTTTGGTTTCAGAACTTGACTGAGGTCCCTAGTGGTGTTTTAGGGC
CAGTCTTTCCATTACTGATTGCTGGATTGCATTATATTAACGTTCAGGTATCTTTTCGGAAATCTTCAGTTGAAAAAATGAGTGGATTCG
TGGGATTAATAGCCAAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan