ESTScan Details for Unigene SGN-U321937

Score 
612
Direction 
Forward
Predicted Peptide Sequence 
TDYPPXYDLLEGEIFLQNLPSIITAHALDPQPGERILDMCAAPGGKTTAIASLMKDKGEVVAVDRSHNKVLGIQKLAAEMGLSCITTYKL
DALKSVCHGAESDSLPYTCSAEDARTPDLLSTGIDGFDAELLFEKIDTVDSLRSNAKYQRRMFDQAVQLVRPGGVIVYSTCTINPGENEA
LVRYALDKYEFLSLASQHPKIGGPGLTGSCQLSDGFVEEWLKPGEEDLVQRFDPSSDLDTIGFFIAKFSVGPKNIRVECDAKSGNR
Predicted Coding Sequence 
XATACAGACTACCCTCCTXTTTATGATTTGCTTGAGGGCGAGATTTTTCTTCAGAACCTTCCAAGCATAATAACTGCACATGCCTTAGAT
CCTCAACCAGGAGAGAGAATATTGGACATGTGTGCAGCTCCAGGGGGGAAAACCACAGCAATAGCAAGCCTTATGAAGGACAAAGGGGAG
GTTGTTGCTGTTGACAGATCTCATAATAAGGTGCTTGGAATTCAGAAATTAGCGGCTGAGATGGGTTTAAGCTGTATAACTACATATAAG
CTTGACGCGCTGAAGTCTGTTTGCCATGGAGCTGAATCTGATAGTTTGCCTTACACATGCAGTGCTGAGGATGCGCGAACACCAGATTTA
TTATCCACTGGTATAGATGGATTTGATGCAGAGTTGCTATTCGAAAAGATTGACACAGTTGATTCCTTGAGGAGTAATGCCAAATATCAG
AGACGAATGTTTGACCAAGCTGTCCAGCTTGTTCGTCCAGGTGGAGTCATTGTCTATTCCACATGTACGATAAACCCTGGTGAGAATGAA
GCATTGGTTCGATATGCATTGGACAAATATGAGTTTCTCTCGTTGGCATCTCAGCATCCAAAAATTGGAGGACCTGGCCTTACTGGTAGT
TGTCAATTGTCTGATGGATTTGTTGAGGAATGGTTAAAGCCCGGTGAAGAAGATCTTGTTCAGAGATTTGATCCATCATCCGACCTTGAT
ACAATAGGATTTTTCATAGCTAAGTTCAGTGTTGGACCCAAAAATATCCGAGTTGAATGTGACGCGAAGTCTGGGAACAGGTGA
Edits in Original Sequence 
(5')XATACAGACTACCCTCCTXTTTATGATTTGCTTGAGGGCGAGATTTTTCTTCAGAACCTTCCAAGCATAATAACTGCACATGCCTT
AGATCCTCAACCAGGAGAGAGAATATTGGACATGTGTGCAGCTCCAGGGGGGAAAACCACAGCAATAGCAAGCCTTATGAAGGACAAAGG
GGAGGTTGTTGCTGTTGACAGATCTCATAATAAGGTGCTTGGAATTCAGAAATTAGCGGCTGAGATGGGTTTAAGCTGTATAACTACATA
TAAGCTTGACGCGCTGAAGTCTGTTTGCCATGGAGCTGAATCTGATAGTTTGCCTTACACATGCAGTGCTGAGGATGCGCGAACACCAGA
TTTATTATCCACTGGTATAGATGGATTTGATGCAGAGTTGCTATTCGAAAAGaATTGACACAGTTGATTCCTTGAGGAGTAATGCCAAAT
ATCAGAGACGAATGTTTGACCAAGCTGTCCAGCTTGTTCGTCCAGGTGGAGTCATTGTCTATTCCACATGTACGATAAACCCTGGTGAGA
ATGAAGCATTGGTTCGATATGCATTGGACAAATATGAGTTTCTCTCGTTGGCATCTCAGCATCCAAAAATTGGAGGACCTGGCCTTACTG
GTAGTTGTCAATTGTCTGATGGATTTGTTGAGGAATGGTTAAAGCCCGGTGAAGAAGATCTTGTTCAGAGATTTGATCCATCATCCGACC
TTGATACAATAGGATTTTTCATAGCTAAGTTCAGTGTTGGACCCAAAAATATCCGAGTTGAATGTGACGCGAAGTCTGGGAACAGGTGA
(3')TTCGGCAGTGAAATTACATTAACTTCGATGATATTAGTTCAGGCCTCTCCTTGTTGTCAACAACATGCTGGAATGTGGGTTGCAGAA
TTAGTTAATGTAACTGTGAATGCAAGATAGAGTATTAAAGATATTTCAACCTTGCATATTGGTCATGATTTTATTTTATTTTACCCCTGT
ACTGATTTTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan