ESTScan Details for Unigene SGN-U322120

Score 
474
Direction 
Forward
Predicted Peptide Sequence 
MGICLSNQIKAETTFYTVSGLDSRNVSGNGTDISNSNSKRSSASIPPTPRSEGEILQSSNLRSFTFNELRSATRNFRPDSVVVEGGFGSV
FKGWVDEHTLAASMPGTGIVIAVKNLDQEGWQGHREWLAEINYLGQLHHPNLENLIGYCLEEDHRLLVYEYRPEGSMENHLFRRGSYYQP
LSWSLRMKVALGAARGL
Predicted Coding Sequence 
ATGGGGATTTGTCTGAGTAACCAAATCAAGGCTGAGACAACATTTTATACTGTTTCAGGGTTGGATTCAAGAAATGTCAGTGGTAATGGT
ACAGATATTAGTAATTCGAATAGCAAACGCTCATCTGCTTCCATACCGCCGACTCCTCGGAGTGAGGGTGAGATCTTGCAATCATCCAAC
TTGAGGAGCTTCACTTTTAATGAACTTCGATCTGCAACCAGAAATTTCCGTCCTGACAGTGTAGTTGTAGAAGGAGGTTTTGGTTCAGTT
TTCAAAGGCTGGGTCGACGAACATACTCTTGCAGCATCAATGCCTGGCACAGGGATTGTGATAGCTGTGAAAAACTTAGACCAAGAAGGG
TGGCAGGGGCACAGAGAATGGCTGGCTGAGATAAACTATCTTGGGCAACTACACCATCCAAATCTTGAAAATTTGATCGGTTATTGCTTA
GAGGAAGATCATAGGCTCTTGGTCTATGAGTATAGGCCTGAGGGTAGCATGGAGAATCATCTATTTCGGAGAGGTTCATACTACCAACCA
CTTTCTTGGAGCCTTCGTATGAAAGTTGCACTTGGTGCTGCAAGGGGCCTT
Edits in Original Sequence 
TCTAATCTATGTTTTTTTCAGTTTTCACCAACAAAAAGTCCAAAAAGAACTTACATTTCTTAAGTACCATAGAGAATCAAGAAAAGCAAT
AAAACCCCTTTTTCCCTCTTGTCCATTTACTTCCAACTTTCTTGTCATATTCTTTTTCATTCATAGGCAAGTGGGGTTAAAGAATTACAG
CTCTGTTCATCAGAAAGTTTCAATCTTTTTCTTTTATCTCCAAAGTTACTGTCATTTCTTGATGTAGAGGAAGATTCTTGGGTTCACACT
AGATCTGGGGTTCAATGAACTTTTGGGGTTTGTATTTAAGTAACAACTGGTGTTAATCTGTGCATACAATGCTGAAAACTTGAGTTTTGC
AGTTTGTCTGGTGGCTAGTGGCTAGTGGCTAGTGGAGCTAAAAAGATTGAATTTTGGGGTGTTTTTTGCTCTA
(5')ATGGGGATTTGTC
TGAGTAACCAAATCAAGGCTGAGACAACATTTTATACTGTTTCAGGGTTGGATTCAAGAAATGTCAGTGGTAATGGTACAGATATTAGTA
ATTCGAATAGCAAACGCTCATCTGCTTCCATACCGCCGACTCCTCGGAGTGAGGGTGAGATCTTGCAATCATCCAACTTGAGGAGCTTCA
CTTTTAATGAACTTCGATCTGCAACCAGAAATTTCCGTCCTGACAGTGTAGTTGTAGAAGGAGGTTTTGGTTCAGTTTTCAAAGGCTGGG
TCGACGAACATACTCTTGCAGCATCAATGCCTGGCACAGGGATTGTGATAGCTGTGAAAAACTTAGACCAAGAAGGGTGGCAGGGGCACA
GAGAATGGCTGGCTGAGATAAACTATCTTGGGCAACTACACCATCCAAATCTTGAAAATTTGATCGGTTATTGCTTAGAGGAAGATCATA
GGCTCTTGGTCTATGAGTATAGGCCTGAGGGTAGCATGGAGAATCATCTATTTCGGAGAGGTTCATACTACCAACCACTTTCTTGGAGCC
TTCGTATGAAAGTTGCACTTGGTGCTGCAAGGGGCCTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan