ESTScan Details for Unigene SGN-U322121

Score 
448
Direction 
Forward
Predicted Peptide Sequence 
RFETASHLTVTNDNDLRQPFFEISAFTCMTFFCVCIRLITQLLKGEXLITKSWDNFILNMVAAVYHQAICFTANEGVRDFLITSSSGSLK
MKPLLRKERCSLRQYVNCVKYSSKSSLCAIKPIFSSLSSTNDSRRTVPESYLILIRHGESMWNEKNLFTGCVDVPLTSKGVEEAIEAGKR
IRHLPIDVVYISALIRSQMTAMLALTEHHCKKVPIIVHDETEQAKVWSQIYSEGTEMQSVPVIKAWQLNERMYGELQGFNKLETAERCGQ
EQVYKWRRSYDARPPNGESLEMCLRRAVTYFKEQIEPQLSSGKNVMVVAHANSLRSILMYLDKLTAEEVIHLELSTGVPMLYIYRENQFI
RRGSPLASMENGVYAYTENLAIYKQNLLDEVLDEGLYNLLRKSKNYHAKLKYLHFTGSSLRYFGSLIIMRNTRVKIKEFLLLHAATATYG
VSKLKXESLVMVQVNAPVEIWQHNSCGTGDIRSNADSTWLSPVIIIXRNYITSFYIVLKPGLLTFTLDFVFFGGFKLQIRLRVHKKCLLA
TTTLKISFSGPGRSFPYAY
Predicted Coding Sequence 
AGGTTTGAAACGGCGTCACATCTGACTGTGACAAATGACAACGACCTCCGGCAGCCATTCTTTGAAATCTCCGCGTTCACATGTATGACC
TTCTTCTGTGTCTGCATTCGTTTGATTACACAGTTATTGAAAGGTGAAGXTTTGATCACAAAGAGTTGGGATAACTTCATACTCAATATG
GTTGCTGCTGTATATCACCAAGCAATTTGCTTCACTGCGAACGAGGGTGTTAGGGACTTCCTGATCACATCTTCATCTGGGAGTCTTAAA
ATGAAACCATTGTTAAGAAAAGAGAGATGCAGTTTGAGGCAGTATGTGAACTGTGTGAAGTATTCATCAAAGTCATCTTTATGTGCCATT
AAGCCAATTTTCTCCTCATTGTCAAGTACCAATGATTCGCGGAGAACAGTTCCTGAATCATACTTGATCTTAATACGGCATGGAGAATCG
ATGTGGAACGAAAAGAACCTGTTCACTGGTTGTGTAGATGTGCCACTCACCAGTAAAGGAGTAGAAGAAGCAATTGAAGCTGGTAAGAGA
ATTAGACACTTACCTATTGATGTTGTCTACATCTCTGCATTGATTCGTTCTCAGATGACGGCCATGCTCGCCCTAACAGAGCACCACTGC
AAGAAGGTGCCCATTATTGTCCACGATGAGACTGAACAAGCCAAAGTATGGAGTCAAATTTATAGTGAAGGCACCGAGATGCAGTCTGTT
CCTGTTATTAAAGCATGGCAACTGAATGAAAGAATGTACGGGGAACTTCAAGGGTTTAATAAGCTAGAAACAGCTGAAAGATGCGGACAA
GAGCAAGTCTATAAATGGCGCCGAAGCTATGATGCTCGGCCACCCAACGGCGAGAGCTTGGAAATGTGCTTGCGAAGAGCTGTTACCTAT
TTCAAAGAGCAAATTGAACCCCAACTTTCCAGTGGAAAGAATGTAATGGTAGTAGCTCATGCAAATTCATTGAGGTCCATCCTAATGTAT
CTCGATAAATTGACTGCAGAGGAGGTCATCCACTTAGAACTCTCAACCGGAGTACCAATGCTTTACATATATAGAGAAAATCAATTCATC
AGGAGAGGAAGTCCCTTGGCATCTATGGAGAATGGAGTTTATGCTTATACAGAGAATTTGGCCATATACAAGCAAAATCTGTTAGATGAA
GTGCTAGATGAAGGTCTTTATAACTTGCTCCGTAAAAGTAAAAACTATCATGCAAAGCTTAAATATCTTCATTTCACTGGAAGTTCATTG
AGGTATTTTGGGTCATTAATAATCATGAGAAACACCAGAGTGAAGATCAAAGAGTTTTTATTGCTACACGCTGCAACAGCAACATATGGT
GTTTCTAAACTCAAAXTTGAGTCCCTTGTTATGGTTCAAGTGAATGCACCAGTGGAAATCTGGCAACACAATTCTTGTGGAACAGGGGAT
ATCAGATCAAATGCTGATTCTACTTGGCTGTCTCCTGTTATCATCATTCXGAGGAACTATATCACTTCATTTTATATTGTCCTCAAGCCA
GGGCTTCTTACATTCACATTAGATTTTGTTTTCTTTGGCGGGTTTAAGTTACAGATTAGGTTGAGAGTGCACAAAAAATGTTTGTTGGCA
ACGACAACTTTAAAAATTTCCTTTTCTGGTCCTGGAAGATCATTTCCATATGCTTATTAA
Edits in Original Sequence 
(5')AGGTTTGAAACGGCGTCACATCTGACTGTGACAAAcTGACAACGACCTCCGGCAGCCATTCTTTGAAATCTCCGCGTTCACATGTA
TGACCTTCTTCTGTGTCTGCATTCGTTTGATTACACAGTTATTGAAAGGTGAAGXTTTGATCACAAAGAGTTGGGATAACTTCATACTCA
ATATGGTTGCTGCTGTATATCACCAAGCAATTTGCTTCACTGCGAACGAGGGTGTTAGGGACTTCCTGATCACATCTTCATCTGGGAGTC
TTAAAATGAAACCATTGTTAAGAAAAGAGAGATGCAGTTTGAGGCAGTATGTGAACTGTGTGAAGTATTCATCAAAGTCATCTTTATGTG
CCATTAAGCCAATTTTCTCCTCATTGTCAAGTACCAATGATTCGCGGAGAACAGTTCCTGAATCATACTTGATCTTAATACGGCATGGAG
AATCGATGTGGAACGAAAAGAACCTGTTCACTGGTTGTGTAGATGTGCCACTCACCAGTAAAGGAGTAGAAGAAGCAATTGAAGCTGGTA
AGAGAATTAGACACTTACCTATTGATGTTGTCTACATCTCTGCATTGATTCGTTCTCAGATGACGGCCATGCTCGCCCTAACAGAGCACC
ACTGCAAGAAGGTGCCCATTATTGTCCACGATGAGACTGAACAAGCCAAAGTATGGAGTCAAATTTATAGTGAAGGCACCGAGATGCAGT
CTGTTCCTGTTATTAAAGCATGGCAACTGAATGAAAGAATGTACGGGGAACTTCAAGGGTTTAATAAGCTAGAAACAGCTGAAAGATGCG
GACAAGAGCAAGTCTATAAATGGCGCCGAAGCTATGATGCTCGGCCACCCAACGGCGAGAGCTTGGAAATGTGCTTGCGAAGAGCTGTTA
CCTATTTCAAAGAGCAAATTGAACCCCAACTTTCCAGTGGAAAGAATGTAATGGTAGTAGCTCATGCAAATTCATTGAGGTCCATCCTAA
TGTATCTCGATAAATTGACTGCAGAGGAGGTCATCCACTTAGAACTCTCAACCGGAGTACCAATGCTTTACATATATAGAGAAAATCAAT
TCATCAGGAGAGGAAGTCCCTTGGCATCTATGGAGAATGGAGTTTATGCTTATACAGAGAATTTGGCCATATACAAGCAAAATCTGTTAG
ATGAAGTGCTAGATGAAGtGTCTTTATAACTTGCTCCGTAAAAGTAAAAACTATCATGCAAAGCTTAAATATCTTCATTTCACTGGAAGT
TCATTGAGGTATTTTGGGTCATTAATAATCATGAGAAACACCAGAGTGAAGATCAAAGAGTTTTTATTGCTACACGCTGCAACAGtCAAC
ATATGGTGTTTCTAAACTCAAAXTTGAGTCCCTTGTTATGGTTCAAGTGAATGCACCAGTGGAAATCTGGCAACACAATaTCTTGTGGAA
CAGGGGATATCAGATCAAATGCTGATTCTACTTGGCTGTCTCCTGTTATCATCATTCXGAGGAACTATATCACTTCATTTTATATTGTCC
TCAAGCCAGGGCTTCTTACATTCACATTAGATaTTTGTTTTCTTTGGCGGGTTTAAGTTACAGATTAGGTTGAGAGTGCACAAAAAATGT
TTGTTGGCAACGACAACTTTAAAAATTTCCTTTTCtTGGTCCTGGAAGATCATTTCCATATGCTTATTAA(3')TGATCTCCTTGTTTCT
GTTTTTTCATGAATGTTGATTTGGTTGTCTTTTTGATCTGCTTCTATATCTTCTGTACAATCCAAATCCTCTATCATAACAGCGGTACTT
GGAGGCAAGATGTATGTAAAAAGTTAGTACTGCACTTTCAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan