ESTScan Details for Unigene SGN-U322122

Score 
588
Direction 
Forward
Predicted Peptide Sequence 
FLQHFKMSNIHGLGKVTKNEKKDVEEFSNSTKQSSSTAVWKPIPTGDTTQDVIAKAKSLSREAPSGGALDRNIALITIYKNGFQIGEAPF
RDLSSPENKQFLEDLRNGEVPAELEGEVRSNFPNAREVAVNLVDKSSEEYQVPKPKFDFAKSQGLSLGSSSGGSSAQNFSGATPKQIEVD
GSKPKTTVQLVLANRTRVRQEFNLDHTVMDVYRHVMFLAKANAPFALWSGFPPKALSDPKATVKEAASRAPLLNSAISSSGYMSDCRIKP
RKA
Predicted Coding Sequence 
XCTTTTCTGCAGCATTTCAAGATGTCAAACATTCATGGTCTCGGCAAAGTAACCAAGAACGAGAAGAAAGATGTTGAGGAATTCTCCAAC
TCGACGAAGCAATCAAGCTCAACAGCGGTATGGAAGCCAATTCCAACTGGCGACACCACCCAAGATGTCATTGCCAAAGCGAAAAGTCTT
TCCAGAGAAGCTCCTTCTGGCGGCGCCCTCGACCGGAATATCGCTCTCATCACAATCTATAAGAATGGATTTCAAATTGGAGAGGCTCCT
TTTCGCGACTTGAGCTCACCAGAAAACAAACAATTCCTCGAAGACCTTCGCAACGGCGAGGTGCCCGCTGAGTTAGAAGGCGAAGTACGA
TCAAACTTTCCCAATGCTCGAGAAGTGGCTGTGAATTTGGTCGACAAATCATCTGAAGAATATCAAGTACCAAAGCCAAAGTTTGACTTT
GCCAAATCTCAAGGCCTGAGTCTGGGAAGCTCATCAGGAGGCTCTTCTGCACAAAACTTTTCTGGGGCAACTCCGAAACAAATTGAAGTA
GATGGTTCAAAGCCCAAGACAACGGTTCAATTGGTTTTGGCCAACCGTACAAGAGTCCGCCAAGAGTTCAATCTTGACCACACTGTAATG
GATGTGTATCGACATGTGATGTTCCTTGCCAAAGCCAACGCGCCCTTCGCGTTGTGGAGCGGGTTTCCGCCTAAGGCTCTTTCTGATCCC
AAGGCTACAGTGAAGGAGGCGGCCTCTCGGGCGCCTCTGTTGAACAGCGCAATTAGCTCCAGCGGCTACATGTCTGACTGTCGAATAAAG
CCTCGGAAGGCTTAA
Edits in Original Sequence 
(5')XCTTTTCTGCAGCATTTCAAGATGTCAAACATTCATGGTCTCGGCAAAGTAACCAAGAACGAGAAGAAAGATGTTGAGGAATTCTC
CAACTCGACGAAGCAATCAAGCTCAACAGCGGTATGGAAGCCAATTCCAACTGGCGACACCACCCAAGATGTCATTGCCAAAGCGAAAAG
TCTTTCCAGAGAAGCTCCTTCTGGCGGCGCCCTCGACCGGAATATCGCTCTCATCACAATCTATAAGAATGGATTTCAAATTGGAGAGGC
TCCTTTTCGCGACTTGAGCTCACCAGAAAACAAACAATTCCTCGAAGACCTTCGCAACGGCGAGGTGCCCGCTGAGTTAGAAGGCGAAGT
ACGATCAAACTTTCCCAATGCTCGAGAAGTGGCTGTGAATTTGGTCGACAAATCATCTGAAGAATATCAAGTACCAAAGCCAAAGTTTGA
CTTTGCCAAATCTCAAGGCCTGAGTCTGGGAAGCTCATCAGGAGGCTCTTCTGCACAAAACTTTTCTGGGGCAACTCCGAAACAAATTGA
AGTAGATGGTTCAAAGCCCAAGACAACGGTTCAATTGGTTTTGGCCAACCGTACAAGAGTCCGCCAAGAGTTCAATCTTGACCACACTGT
AATGGATGTGTATCGACATGTGATGTTCCTTGCCAAAGCCAACGCGCCCTTCGCGTTGTGGAGCGGGTTTCCGCCTAAGGCTCTTTCTGA
TCCCAAGGCTACAGTGAAGGAGGCgGGCCTCTCGGGCGCCTCTGTTGAACAGCGCAATTAGCTCCAGCGGCTACATGTCTGACTGTCGAA
TAAAGCCTCGGAAGGCTTAA(3')ATCGAAAAAAAAAAAAAAAAAAACTCGAGGGGGGCCCGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan