ESTScan Details for Unigene SGN-U322246

Score 
563
Direction 
Forward
Predicted Peptide Sequence 
MGKELDHSKSLDKEEAVIMQNIDEDEIFPPEKNRNSLCIRKIEGNKKTXDALNEDGSLDSAEESPVHGKSLCLARSFSSHFLINIDEMMS
DVGNEKGALIKNNILKSKDQEDDDSCSWNRIQIEPTLRIRLKFQDVKYSVALKGVENSDTEKCILQGVSGSACPGEILALMGPSGGGKTT
LLKLLSGKVKNDSGTITFNDQPX
Predicted Coding Sequence 
ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGAGGCTGTCATCATGCAGAATATCGATGAGGATGAGATTTTTCCACCT
GAAAAAAACAGGAATAGTTTGTGCATTCGGAAAATAGAAGGCAATAAAAAGACTAXAGACGCGCTTAATGAAGATGGAAGCCTAGACTCT
GCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCTAGCAAGATCATTTAGTTCTCATTTTCTTATTAACATAGATGAGATGATGAGT
GATGTTGGTAATGAAAAAGGTGCACTTATAAAGAACAATATATTGAAATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGGAATAGA
ATTCAGATTGAGCCTACCTTACGTATACGTCTCAAGTTTCAAGATGTGAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCTGATACA
GAAAAGTGCATACTTCAAGGAGTGAGTGGTTCAGCCTGTCCAGGAGAAATTCTCGCGTTAATGGGACCTTCCGGTGGTGGTAAAACAACC
TTACTCAAGCTTCTAAGTGGAAAGGTGAAAAATGATAGTGGCACGATTACTTTCAATGACCAGCCATAN
Edits in Original Sequence 
CATAGATCTTCCTAAGTTTGAGGTCTAACCAACCGAGATAA(5')ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGAG
GCTGTCATCATGCAGAATATCGATGAGGATGAGATTTTTCCACCTGAAAAAAACAGGAATAGTTTGTGCATTCGGAAAATAGAAGGCAAT
AAAAAGACTAXAGACGCGCTTAATGAAGATGcGAAGCCTAGACTCTGCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCTAGCAAG
ATCATTTAGTTCTCATTTTCTTATTAACATAGATGAGATGATGAGTGATGTTGGTAATGAAAAAGGTGCACTTATAAAGAACAATATATT
GAAATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGGAATAGAATTCAGATTGAGCCTACCTTACGTATACGTCTCAAGTTTCAAGA
TGTGAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCTGATACAGAAAAGTGCATACTTCAAGGAGTGAGTGGTTCAGCCTGTCCAGG
AGAAATTCTCGCGTTAATGGGACCTTCCGGTGGTGGTAAAACAACCTTACTCAAGCTTCTAAGTGGAAAGGTGAAAAATGATAGTGGCAC
GATTACTTTCAATGACCAGCCATAN(3')TACAAGTCGTTGAAACAAAGGATCGGGTTTGTGCTACAAGAATGATGTGTTTTTCCCCATC
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan