ESTScan Details for Unigene SGN-U322257

Score 
219
Direction 
Forward
Predicted Peptide Sequence 
MTRIFAKPASHLRHLQQSLKNKSFSNDVPWWRQILDPNSDIVNRWNYVFLLTCLISLFIDPLYFYVPFVSDRACMSTDDEAAREITIYRS
LTDIFYFLHIAMKFRTAFVAPSSRVFGRGELVMDPREIAIRYLKTDFIVDFTAALPLPQIVIRYVIPAAKRNGSGHSKSTLALIVLIQYV
Predicted Coding Sequence 
ATGACTAGAATATTTGCAAAGCCGGCGTCTCACCTCCGTCATTTACAGCAATCTTTGAAGAACAAATCATTTTCGAACGATGTGCCATGG
TGGCGCCAAATTCTCGATCCAAACAGCGATATCGTCAATCGCTGGAACTATGTCTTCCTCCTTACCTGTCTCATCTCTCTTTTCATCGAT
CCACTCTACTTCTACGTACCTTTCGTCAGCGATAGAGCTTGTATGTCCACTGATGACGAAGCCGCCCGTGAAATTACCATCTATCGTTCT
CTCACCGACATCTTTTACTTCCTTCACATTGCCATGAAGTTCCGCACAGCTTTTGTTGCTCCGAGCTCTAGGGTTTTCGGCCGGGGTGAG
CTTGTTATGGACCCCCGTGAAATTGCTATACGATATCTCAAAACTGATTTCATCGTTGATTTTACAGCTGCTCTTCCCCTGCCTCAAATT
GTTATTCGCTATGTAATCCCAGCAGCAAAAAGAAATGGTTCGGGTCATTCCAAAAGTACACTTGCACTTATCGTTCTCATACAATATGTX
Edits in Original Sequence 
TTTGATGAAAAAAGGAGCTTCAATGGAACACTCTTAATTCATTCTTCCTTCTTTTCTAGCGCTAATTTTCACTCACTGTTTCATTCATAA
TACAAAAAAATTATTGGAATCTGTTGTGTTTTCCAGAAGAGAGACAATCTTCCGGAATCCGATTTTGATATCGGACTCCGCCATGGAAG
(5')ATGACTAGAATATTTGCAAAGCCGGCGTCTCACCTCCGTCATTTACAGCAATCTTTGAAGAACAAATCATTTTCGAACGATGTGCCA
TGGTGGCGCCAAATTCTCGATCCAAACAGCGATATCGTCAATCGCTGGAACTATGTCTTCCTCCTTACCTGTCTCATCTCTCTTTTCATC
GATCCACTCTACTTCTACGTACCTTTCGTCAGCGATAGAGCTTGTATGTCCACTGATGACGAAGCCGCCCGTGAAATTACCATCTATCGT
TCTCTCACCGACATCTTTTACTTCCTTCACATTGCCATGAAGTTCCGCACAGCTTTTGTTGCTCCGAGCTCTAGGGTTTTCGGCCGGGGT
GAGCTTGTTATGGACCCCCGTGAAATTGCTATACGATATCTCAAAACTGATTTCATCGTTGATTTTACAGCTGCTCTTCCCCTGCCTCAA
ATTGTTATTCGCTATGTAATCCCAGCAGCAAAAAGAAATGGTTCGGGTCATTCCAAAAGTACACTTGCACTTATCGTTCTCATACAATAT
GTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan